Property Summary

Ligand Count 59
NCBI Gene PubMed Count 758
PubMed Score 4688.02
PubTator Score 4568.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical adenoma -1.022 9.3e-03
astrocytic glioma 1.500 1.2e-02
cutaneous lupus erythematosus -1.800 6.9e-04
ependymoma 1.400 3.6e-02
intraductal papillary-mucinous neoplasm ... 1.300 8.2e-03
medulloblastoma, large-cell 1.300 3.6e-04
oligodendroglioma 1.300 2.3e-02
pancreatic ductal adenocarcinoma liver m... -1.124 4.3e-02
psoriasis -1.400 1.5e-03

PDB (31)

Gene RIF (767)

AA Sequence

MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGK      1 - 70
VWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSG     71 - 140
KLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKL    141 - 210
LRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQN    211 - 280
SKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTV    281 - 350
LQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS    351 - 420
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVV    421 - 490
LKVESRDGTVSGA                                                             491 - 503
//

Text Mined References (768)

PMID Year Title