Property Summary

NCBI Gene PubMed Count 28
PubMed Score 23.83
PubTator Score 32.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
psoriasis 6514 0.0 2.07769986348588E-57
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.500 2.1e-57
intraductal papillary-mucinous adenoma (... 1.200 1.4e-03
non-small cell lung cancer 1.791 2.4e-08
pancreatic cancer 1.500 2.3e-03
ulcerative colitis -1.300 5.8e-04

 MGI Phenotype (1)

Gene RIF (17)

AA Sequence

MEATGTWALLLALALLLLLTLALSGTRARGHLPPGPTPLPLLGNLLQLRPGALYSGLMRLSKKYGPVFTI      1 - 70
YLGPWRPVVVLVGQEAVREALGGQAEEFSGRGTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGM     71 - 140
GKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLLFGLRFSYEDKEFQAVVRAAGGTLL    141 - 210
GVSSQGGQTYEMFSWFLRPLPGPHKQLLHHVSTLAAFTVRQVQQHQGNLDASGPARDLVDAFLLKMAQEE    211 - 280
QNPGTEFTNKNMLMTVIYLLFAGTMTVSTTVGYTLLLLMKYPHVQKWVREELNRELGAGQAPSLGDRTRL    281 - 350
PYTDAVLHEAQRLLALVPMGIPRTLMRTTRFRGYTLPQGTEVFPLLGSILHDPNIFKHPEEFNPDRFLDA    351 - 420
DGRFRKHEAFLPFSLGKRVCLGEGLAKAELFLFFTTILQAFSLESPCPPDTLSLKPTVSGLFNIPPAFQL    421 - 490
QVRPTDLHSTTQTR                                                            491 - 504
//

Text Mined References (28)

PMID Year Title