Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.1e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.500 1.1e-03

Gene RIF (2)

PMID Text
17494644 Observational study of genotype prevalence. (HuGE Navigator)
12171760 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFS      1 - 70
LQLAWTPVVVLNGLAAVREAMVTRGEDTADRPPAPIYQVLGFGPRSQGVILSRYGPAWREQRRFSVSTLR     71 - 140
NLGLGKKSLEQWVTEEAACLCAAFADQAGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQ    141 - 210
EGLKEESGFLREVLNAVPVLPHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAKKE    211 - 280
KAKGSPESSFNDENLRIVVGNLFLAGMVTTSTTLAWGLLLMILHLDVQRGRRVSPGCPIVGTHVCPVRVQ    281 - 350
QEIDDVIGQVRRPEMGDQAHMPCTTAVIHEVQHFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSV    351 - 420
LKDEAVWKKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVAAGQ    421 - 490
PRPSHSRVVSFLVTPSPYELCAVPR                                                 491 - 515
//

Text Mined References (15)

PMID Year Title
26297049 2016 Coding-noncoding gene expression in intrahepatic cholangiocarcinoma.
22111604 2012 CYP2D6, SULT1A1 and UGT2B17 copy number variation: quantitative detection by multiplex PCR.
18838503 2009 Expression and functional analysis of CYP2D6.24, CYP2D6.26, CYP2D6.27, and CYP2D7 isozymes.
17494644 2007 Frequency of the frame-shifting CYP2D7 138delT polymorphism in a large, ethnically diverse sample population.
16400609 2006 Single-nucleotide polymorphisms in NAGNAG acceptors are highly predictive for variations of alternative splicing.
16169517 2005 CYP2D7 splice variants in human liver and brain: does CYP2D7 encode functional protein?
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15051713 2004 A frameshift mutation and alternate splicing in human brain generate a functional form of the pseudogene cytochrome P4502D7 that demethylates codeine to morphine.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12171760 Polymorphism of metabolic genes and susceptibility to occupational chronic manganism.
10591208 1999 The DNA sequence of human chromosome 22.
3123997 1988 Characterization of the common genetic defect in humans deficient in debrisoquine metabolism.
2574001 1989 The human debrisoquine 4-hydroxylase (CYP2D) locus: sequence and identification of the polymorphic CYP2D6 gene, a related gene, and a pseudogene.
1978251 1990 Identification of the primary gene defect at the cytochrome P450 CYP2D locus.
1358797 1992 Evolution of a highly polymorphic human cytochrome P450 gene cluster: CYP2D6.