Property Summary

NCBI Gene PubMed Count 889
PubMed Score 3352.94
PubTator Score 3522.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.300 1.1e-03

Gene RIF (968)

PMID Text
26902503 Plasma points from 1 to 30 hours after single dose of 30-mg dextromethorphan(DM) and any plasma point at steady state after multiple doses of DM could potentially be used for phenotyping of CYP2D6.
26839488 No evidence provide for the contribution of CYP2D6 polymorphism to either drug response or CC concentrations.
26768225 The ApoE E3 allele and the CYP2D6 rs1065852 polymorphism may provide clinically relevant information for predicting therapeutic responses to donepezil therapy.
26652007 the first study to conduct functional analysis of CYP2D6 four novel high frequency alleles in Chinese Han population
26603528 CYP2D6 polymorphisms are significantly associated with therapeutic responses to donepezil in patients with Alzheimer's disease.
26551314 CYP2D6 copy number variation may account for the single most impactful genetic anomaly as it relates to pharmacogenetic directed therapies
26514968 Genotype and co-medication dependent CYP2D6 metabolic activity: effects on serum concentrations of aripiprazole, haloperidol, risperidone, paliperidone and zuclopenthixol
26510986 CYP2D6 genetic polymorphisms and phenotypes in Malaysian breast cancer patients for different ethnicities
26434912 CYP2D6 metabolism, as measured by genetic variation, can be a predictor of breast cancer outcome in Her2-neu positive women receiving tamoxifen.
26406933 CYP2D6 variants have an effect on venlafaxine metabolism in the Han Chinese population
26369533 CYP2D6 genotype- and endoxifen-guided tamoxifen dose escalation increases endoxifen serum concentrations without increasing side effects
26316040 CYP2D6*10 polymorphisms (rs1065852 and rs1135840) were significantly associated with blood desethylhydroxychloroquine:hydroxychloroquine ratio in SLE patients.
26310775 CYP2D6 variants affect bufuralol and dextromethorphan in a Chinese population
26298540 Results suggest that CYP2D6 and CYP2C19 genotyping alone probably do not improve the prediction of treatment resistance in schizophrenia
26287939 Found associations between CYP2D6 genotype and smoking habits; the poor metabolizer genotype tended to decrease the risk of becoming a heavy smoker compared with extensive metabolizers Ultrarapid metabolism-related genotypes tended to increase the risk.
26252353 TUBB3, TOP2A, CYP19A1 and CYP2D6 gene expression, but not protein expression, was associated with patient survival in breast cancer .
26235034 The study results may suggest the impact of CYP2D6 gene polymorphism (A2637 deletion) on a higher prevalence of bullous pemphigoid.
26230381 preemptive genotyping for CYP2D6 currently appears to have no clinical implications in treatment-resistant depressive patients indicated for electroconvulsive therapy.
26211952 influence of four polymorphisms and gene duplication in CYP2D6 on in vivo enzyme activity in a Chilean mestizo population in order to identify the most relevant genetic profiles that account for observed phenotypes in this ethnic group
26084127 No relationship between therapeutic responses to metoprolol in stage 1 hypertensive patients and CYP2D6*4 genotype in an Indian population.
25999696 The CYP2D6*4 (G1846A) and *14 (G1758A) allelic frequencies were not detected in different ethnicities
25989235 In respect to the normal CYP2D6 phenotype, our results suggested that slowly metabolizers (IMs and PMs) might have a major sedation, whereas more rapid metabolizers (UM) a minor sedation.
25967538 The pharmacokinetics of controlled-release paroxetine after a single administration was affected by CYP2D6 polymorphisms.
25963137 Our study demonstrates a possible role in recurrence prediction of CYP2D6*4 genotypes in Male Breast Cancer patients which could mean that some of them benefit less from adjuvant tamoxifen.
25943116 Data indicate that EE2-induced cholestasis increases SHP and represses CYP2D6 expression in Tg-CYP2D6 mice in part through ERa transactivation of Shp promoter.
25941923 In native and Mestizo populations of Mexico, there was sharing of CYP2D6 alleles.
25933954 Compared to Hungarians, the Roma population sample had an increased frequency of functional minor allele variants in CYP2D6 (and CYP2B6).
25868121 SNPs affect serum levels of metabolized antipsychotics to a limited extent
25857198 CYP2D6, CYP3A5, and CYP3A4 gene polymorphism in Russian, Tatar, and Bashkir populations
25825958 This study investigated the influence of human cytochrome P450 2D6 (CYP2D6) gene polymorphism in gastric cancer (GC) patients
25823457 There was no significant interaction between the effects of ADRB1 and CYP2D6 gene polymorphisms on treatment outcome.
25803758 This study demonstrated that Clinical evaluation of analgesic ineffectiveness and adverse effects led to the high likelihood of identifying patients with CYP2D6, CYP2C19, and CYP2C9 alleles associated with alterations in analgesic metabolism.
25788121 The assay identifying 1023C>T (rs28371706) defining a reduced function (CYP2D6*17) and several nonfunctional alleles, produced a small number of unexpected diplotype calls.
25743120 CYP2D6*10 variant genotype demonstrated worse clinical effects in infertile men with idiopathic oligozoospermia treated with tamoxifen citrate and testosterone undecanoate
25720195 the frequencies of Ultra-rapid Metabolizers and Poor Metabolizers for CYP2D6 varied widely across the mestizo, Amerindian and Afro-Caribbean Costa Rican populations.
25701109 The aim of this study was to evaluate the association of CYP2D6*10, OATP1B1 A388G, and OATP1B1 T521C polymorphisms with overall survival for breast cancer patients after adjuvant tamoxifen therapy.
25609939 PHARMACOGENETIC VARIANTS IN THE CYP2D6 GENE MAY ALTER THE PHARMACOKINETICS OF ACETYLCHOLINESTERASE INHIBITORS IN PATIENTS WITH Alzheimer's DISEASE
25555909 Contributions of ionic interactions and protein dynamics to cytochrome P450 2D6 (CYP2D6) substrate and inhibitor binding.
25552922 Allele frequency of CYP2D6 polymorphisms in the Japanese population
25521354 Identification and validation of M1 may provide a noninvasive means of CYP2D6 phenotyping.
25510856 We propose using O-desmethylvenlafaxine/venlafaxine for CYP2D6 phenotyping, and O-desmethylvenlafaxine/venlafaxine with venlafaxine + O-desmethylvenlafaxine for predicting venlafaxine treatment outcomes in future prospective studies.
25495408 The present data support previous findings reporting a very low frequency of CYP2D6 PMs in Mexican-Amerindians
25495406 the polymorphic enzymes CYP2C19 and CYP2D6 indeed have endogenous functions in the development and regulation of specific neuronal pathways, translating into inter-individual differences in cognition and risk for depression and suicide.
25469868 Reprot functional assessment of 22 newly identified CYP2D6 allelic variants found in the Chinese population.
25437930 Suicide attempters carrying two or more active CYP2D6 genes were more likely to be diagnosed with at least one personality disorder than those with one or zero CYP2D6 active genes.
25381333 Effects of both the enhancer element and SNP rs5758550 on CYP2D6 gene expression were demonstrated.
25378122 Evaluation of endometrial thickness and bone mineral density based on CYP2D6 polymorphisms in Turkish breast cancer patients receiving tamoxifen treatment
25329392 The analysis of molecular variance showed that CYP2D6 is homogeneously distributed across different Brazilian regions and most of the differences can be attributed to inter-individual differences.
25329115 The CYP2D6 genotype in children and adolescents with schizophrenia and bipolar disorder, proved to be a good predictor for the response to atypical antipsychotics and the side effects registered.
25296365 We conclude that patients with reduced CYP2D6 activity did not present worse tumor characteristics or decreased disease-free survival than women with normal enzyme activity, as the difference was not statistically significant.
25261563 Paroxetine and other CYP2D6 inhibitors can have a clinically important interaction with ophthalmic timolol.
25245581 The S/R ratios of VEN were significantly influenced by both CYP2D6 and CYP2C19 genotypes.
25240994 We suggest CYP2D6 4 genotype as a disease-susceptible genotype and low or high CYP1A2 activity levels as indicators of environmental influence in OLP subgroups.
25217496 increased KLF9 expression is in part responsible for CYP2D6 induction during pregnancy via the potentiation of HNF4alpha transactivation of CYP2D6.
25141893 Both novel CYP2D6*1 subvariants are functional.
25138301 The current study demonstrates that the CYP1A1 and CYP2D6 polymorphisms are associated with susceptibility to both development and progression of HNSCC.
25113522 The observed relationship is mediated by the role of CYP2D6 and CYP2C19.
24987171 The prevalence of CYP2D6 polymorphism in Western Indian population is low (3.36%) and is similar to other populations
24948072 Polymorphism of the gene encoding CYP2D6 does not affect the incidence of inflammatory bowel diseases.
24909950 Our data support that the CYP2D6*4 polymorphism but not CYP2D6 phenotypes might be associated with increased Alzheimer's disease risk, particularly in Caucasian populations.
24905532 CYP2D6 genotype remains a major determinant of the metoprolol plasma concentrations.
24865344 Sperm acrosin activity index, concentration, motility, linear sperm velocity and sperm normal forms were significantly higher, and seminal MDA level was significantly lower in men with CYP450-2D6*4 wild-type allele compared to homozygous mutation.
24858822 Impact of age on serum concentrations of venlafaxine and escitalopram in different CYP2D6 and CYP2C19 genotype subgroups
24798722 The investigators conducted a retrospective analysis of 1143 individuals with known CYP2D6, CYP2C19 and CYP2C9 genotypes for drug interactions
24682161 The findings of this study suggest that CYP2D6, but not CYP3A5 or ABCB1, play an important role in controlling steady-state plasma concentrations of aripiprazole and its metabolite.
24663076 The results confirm the influence of CYP2D6 genetic variants in fluoxetine pharmacokinetics and provide evidence for the potential effect of the ABCB1 genotype on the clinical improvement in children and adolescent patients treated with fluoxetine.
24660534 An association between CYP2D6 gene duplication and the therapeutic efficacy of venlafaxine, is reported.
24640604 CYP2D6*10 genetic polymorphism has a significant impact on the pharmacokinetics of tramadol in Chinese post-operative patients
24557547 High-altitude hypoxia decreases the activity and expression of CYP1A1 and NAT2, but increases that of CYP2D6.
24533713 Our data show a lower frequency of CYP2D6 inactive alleles and a higher frequency of duplication/multiplication of CYP2D6 active alleles in indigenous populations that in Mestizos.
24510399 Curcuma significantly inhibits CYP2D6 mediated transformation of dextromethorphan in in vitro as well as in vivo; which indicates that curcuma has potential to interact with CYP2D6 substrates.
24495562 Using CYP2D6 phenotype-specific oxycodone pharmacokinetic parameter values derived from published data, our hypothesis predicted that the canonical order of oxycodone's addictive potential was UM>EM>IM>PM
24488700 This study demonistrated that gene polymorphisms of CYP2D6 did not predict SSRI responses in Chinese Han depressed patients. Neuroendocrine factors also were not significant independent predictors for SSRI responses.
24449363 Genetic polymorphisms in CYP1A1 and CYP2D6 may significantly associate with HNC in the Tunisian population.
24376807 The CYP2D6*4G/A polymorphism denotes an increased genetic susceptibility to Parkinson's Disease in the overall population, especially in Caucasians.
24340040 the number of drugs that are metabolized by each CYP, the impact of CYP SNPs, as well as CYP expression patterns in different tissues. The most important polymorphic CYPs were found to be 1A2, 2D6, 2C9 and 2C19.
24338437 Data suggest that CYP2C9, CYP2C19, and CYP2D6 SNPs and haplotypes may affect the response to antiepileptic drugs.
24329190 Our present findings suggest that genetic polymorphisms of CYP2D6 may be important predictors of the clinical outcomes of adjuvant tamoxifen treatment for the patients with breast cancer
24329187 Our study demonstrates that CYP2D6 predicted 65% of the risperidone metabolism variability
24318876 SHP repressed HNF4alpha transactivation of CYP2D6 promoter.
24279852 The presence of the -1584G allele in the promoter region of the CYP2D6 gene was related to a high CYP2D6 hydroxylation capacity
24265353 Mutant alleles of CYP2D6 rs1800716 are associated with an increased chance of having a double endometrial thickness of 5 mm or more in postmenopausal women on tamoxifen.
24265036 the CYP2D6 genotypes and phenotypes were not associated with the occurrence of hot flashes.
24257813 CYP2D6 genotype was significantly associated with nortriptyline and 10-hydroxynortriptyline serum concentrations and 10-hydroxynortriptyline:nortrip-tyline ratio
24232670 Here, we developed a novel mediation analysis approach to identify new expression quantitative trait loci (eQTL) driving CYP2D6 activity by combining genotype, gene expression, and enzyme activity data
24211060 This meta-analysis demonstrates that the poor metabolizer phenotype of CYP2D6 confers a significant susceptibility to Parkinson's disease.
24192122 This study provides the most comprehensive data concerning CYP2D6 polymorphisms in the Chinese Han population to date and increases the number of known alleles
24161632 Variant alleles of CYP2D6 occur in different ethnic groups. CYP2D6 polymorphisms affect drug metabolism, including tamoxifen activation. Review.
24156754 Distribution of the gene polymorphism of CYP2D6*10 is ethnically and geographical different. The allele T of CYP2D6*10 is not related to hyperlipidemia. CC expression seemed to increase the lipid-lowering effects of simvastatin. The hyperlipidemia patients with CC genotype should take lower doses of simvastatin than those with CT/TT genotype in the Ningxia Hui population.
24151801 Clinical assessment of CYP2D6 and CYP2C19 metabolizer status is feasible, well accepted and optimizes drug treatment in psychiatry.
24151800 This review provides a summary of the intricacies of CYP2D6 variation and genotype analysis, knowledge that is invaluable for the translation of genotype into clinically useful information.
24125101 CYP2D6 genotype was not associated with tamoxifen treatment outcome
24121619 The allelic frequency of CYP2D6*41 was found to be 18.4%, and that of CYP2D6*29 to be 2.9%
24113184 HIV-1 gp120 upregulates the expression of cytochrome p450 family proteins CYP2E1, CYP2D6, and CYP2B6 in astrocytes
24112176 CYP2D6*3 or *4 polymorphism might not be associated with acute leukemia susceptibility
24107805 CYP2D6 polymorphism, though not significant, might partially be involved in the plasma concentration of Alzheimer's disease drugs
24098545 CYP2D6 genetic polymorphisms may not correlate with the response to tamoxifen in breast cancer patients.
24089073 These preliminary findings suggest that elderly CYP2D6/CYP2C19 poor metabolizers with a high anticholinergic drug burden are at increased risk of elevated serum anticholinergic activity
24088226 there is a significant association between CYP2D6 metabolizer status and percent mammographic density(PMD)change, suggesting that the capacity for PMD change may be inherited.
24088129 CYP2D6 genotyping predicted that 90.8% of patients were normal metabolizers.
24088126 CYP2D6 genotype partially determines haloperidol metabolism.
24033670 This review summarizes the findings on CYP2D6 polymorphisms and their role in endogenous substrate metabolism as well as the large body of association studies reporting the possible functional consequences of the polymorphism. polymorphism.
23985325 SNP defining the CYP2D6 *2 allele alters exon 6 splicing, thereby reducing CYP2D6 expression at least 2-fold. In addition, two completely linked SNPs increase CYP2D6 transcription more than 2-fold located >100 kb that interacts with the CYP2D6 promoter.
23981149 CYP2C19 and CYP2D6 genotypes have impacts on the clearance of citalopram
23922954 the CYP2D6 genotype inducing the conversion of TAM to potent hydroxylated metabolites in a manner consistent with a gene-dose effect.
23897164 Polymorphisms of CYP2D6 indicated that specific mutations showed significant reductions in enzymatic activities.
23893861 CYP2D6 gene polymorphism is associated with response to therapy in breast cancer.
23876819 Deoxyelephantopin produced no significant effect on CYP1A2 and CYP2D6 expression.
23872830 CYP2D6 genotype should not be used to determine endocrine therapy in postmenopausal breast cancer patients
23870808 This review summarizes evidence for the role of CYP450 genetic variants in the response to antipsychotic medications and the clinical implications of pharmacogenetics in the management of patients with schizophrenia.
23855716 When evaluation CYP2D6 genotype/phenotype, poor metabolizers were less likely to develop methamphetamine related heart failure.
23851570 results show that CYP2D6 variants may have an effect on the susceptibility to risperidone-induced hyperprolactinemia.
23842856 No association between the CYP2D6 genotypes or phenotypes and tamoxifen efficacy was found in our study
23831869 A trend was observed suggesting an inverse association between CYP2D6 genotype and the switch to the antipsychotic clozapine.
23809878 Intravenous infection caused an accumulation of hCYP2D6-specific CD4 T cells.
23803265 CYP2D6 is responsible for codeine metabolism as well as the metabolism of about 25% fo all drugs.
23781139 CYP2D6 and CYP2C19 genotyping appears advisable before the prescription of tamoxifen therapy.
23737191 CYP2D6 duplication or multiplication does not play a significant role in antidepressant pharmacotherapy failure in this patient sample
23734807 CYP2D6 enzymatic functional status significantly affected length of hospital stay.
23733622 Cancer cachexia raised the plasma exposures of oxycodone and oxymorphone through the reduction of CYP3A but not CYP2D6.
23728524 Mirabegron is a moderate CYP2D6 inhibitor.
23712329 CYP2D6 polymorphisms may influence tamoxifen treatment outcomes of disease-free survival in breast cancer patients.
23700791 the effect of genotype of CYP2D6 on clinical outcome of diltiazem treatment is expected to be limited
23691026 species selectivity in rat and human cytochrome P450 2D enzymes
23686417 Our results show a significant influence of the CYP2D6 genotype on the efficacy of Tam in the treatment of advanced breast cancer.
23664723 Polymorphisms of CYP2D6 gene is associated with gefitinib-induced hepatotoxicity in lung cancer.
23644254 CYP2D6 gene haplotype classification and identification of novel polymorphic sites in a Tibetn population.
23614566 The transgenic-2D6 mouse model may serve as a valuable in vivo tool to determine CYP2D6-involved neurophysiological metabolism and function.
23609392 our results confirmed the influence of CYP2D6 genotype on plasma levels of risperidone and on potential drug-related adverse effects
23570465 CYP2D6 remained an independent predictor of outcome.
23558964 The present meta-analysis supported the positive association of CYP2D6 T188C variant with lung cancer in the Chinese.
23555934 The number of functionally active CYP2D6 alleles had an impact on oxycodone metabolism. The genotype also impacted analgesic consumption, thereby causing variation of equianalgesic doses piritramide : oxycodone.
23552177 Data suggest that mutation of CYP2D6 at active site residues 216 and 483 changes the capability of CYP2D6 to hydroxylate testosterone; mutation F483G leads to preferred hydroxylation at 2beta-position of testosterone.
23545896 Our study is the first to indicate that CYP2D6 and CYP2C19 may have a role in antidepressant response in obsessive-compulsive disorder .
23503455 The CYP2D6 genotype significantly influences galantamine plasma concentrationsis and is an important determinant of galantamine pharmacokinetics.
23471717 In south central China patients with lung cancer, a three-order interaction between CYP2D6, CYP1A1, and CYP2A6 polymorphisms is found.
23469064 functionally characterized the single nucleotide polymorphisms (SNPs) of the promoter region and corresponding haplotypes in this population
23394389 CYP2D6*100 is characterized by a single nucleotide deletion and CYP2D6*101 by a 19-bp deletion; both cause frameshifts.
23357843 Report pharmacokinetic model to quantitatively estimate drug-drug interactions of paroxetine and CYP2D6 substrate drugs, and to predict optimal dosage regimens.
23350374 Polymorphism of CYP2D6 gene has been investigated in relation to the prognosis of tamoxifen therapy.
23292115 investigation of HNF4alpha genetic polymorphisms may improve the predictability of CYP2D6 activity in different populations
23289191 results suggest a new association between CYP2D6 gene duplication and side effects to tamoxifen, indicating a possible role of CYP2D6 in their occurrence.
23280482 aside from the need for a longer titration in the ultrarapid metabolizers, there are no distinguishing features of patients with various CYP2D6
23277250 Report effect of CYP2D6 inhibition on iloperidone-induced alterations of QT interval.
23258538 dopaminergic neurons expressing mitochondrial CYP2D6 are fully capable of activating the pro-neurotoxin MPTP and inducing neuronal damage, which is effectively prevented by the CYP2D6 inhibitor quinidine
23213055 the CYP2D6 PM/PM phenotype was associated with a higher likelihood of an early disease event in women treated with 5 years of tamoxifen but not in patients treated with sequential tamoxifen followed by anastrozole.
23212934 Coadministration of tramadol and serotonin reuptake inhibitors has caused serotonin syndrome; CYP2D6 poor metabolizers are at a greater risk of serotonin syndrome and an inadequate analgesic effect.
23207012 CYP2D6 phenotypes are a risk factor for the development of rash in response to gefitinib therapy.
23167378 Post-menopause breast cancer patients with homozygous CYP2D6*10 and who are intermediate metabolizers have shorter disease-free survival.
22994728 There was a positive association between CYP2D6 heterozygote (GC) of rs1135840 and cancer risk.
22986607 AD patients with mutant allele (*10) in CYP2D6 gene may respond better to donepezil than those with wild allele (*1). We did not find the relationship between APOE [Latin Small Letter Open E]4 status and the efficacy of donepezil in our study.
22948856 Pridopidine dose adjustment is not required in poor/extensive CYP2D6 metabolizers.
22929407 A 1-compartment mixture model described risperidone and (+/-)-9-hydroxyrisperidone clearances for 3 CYP2D6 metabolizer subpopulations.
22913530 We detected by SNaPshot((R)) different polymorphisms in CYP2D6 and CYP2C19 in poor metabolizer phenotypes in western Mestizos and five Amerindian groups from Mexico.
22905959 The allelic distributions of the CYP2D6 gene among Jordanians are different from other Mediterranean groups, especially the *10 and *17 single-nucleotide polymorphisms, and the CYP2D6*2xN duplication allele.
22803153 There is an association between CYP2D6 (1846G/A) genotype and rapid liver cirrhosis development.
22777153 CYP2D6 genotyping indicated a prevalence of 4.1% poor metabolizer.
22775532 Although not conclusive, there was some association between CYP2D6 impaired metabolic status and medication response.
22735900 Data from the preventive IBIS-I study did not support an association between the CYP2D6 phenotype and breast cancer outcome.
22733239 A 29.2 or 15.3% sample size reduction would have been possible if the recruitment had been of individuals carrying just 0 or 0 plus 1 CYP2D6 active genes.
22718526 Findings suggest variability in CYP2D6 impacts susceptibility to postoperative nausea and vomiting.
22700965 Although both the hepatic CYP2A6 and respiratory CYP2A13 enzymes metabolize these compounds, CYP2A13 does so with much higher catalytic efficiency, but the structural basis for this has been unclear
22688624 Corresponding enzyme variants may result in poor, intermediate, and extensive metabolization and therefore different steady-state plasma levels of active metabolites. Those are hypothesized to be linked to clinical outcomes of tamoxifen therapy.
22661184 The obtained results may suggest the influence of CYP2D6*4 gene mutated alleles on increased incidence of systemic sclerosis.
22623266 Combined ABCB1 3435C>T and CYP2D6*10 genotypes had a significant (P < 0.01) effect on the fraction of metabolite absorbed from the depot.
22623212 Data suggest that reduced CYP2D6 activity is associated with poor treatment outcomes, in terms of increased risk of recurrence and shorter recurrence free survival, in breast cancer patients on adjuvant tamoxifen therapy.
22531512 The effect of interaction of the risk modifiers such as cigarette smoking or tobacco chewing or alcohol drinking with the CYP2D6 genotypes in the controls and patients was found to be significant for susceptibility to head and neck cancer.
22497725 CYP2D6 genetic polymorphisms and smoking are associated with the development of acute severe postoperative pain in female surgical patients immediately after general anesthesia.
22459173 the unliganded CYP2D6 is compressible, quinidine binding significantly rigidifies the CYP2D6 active site.
22428763 CYP2D6 plays a significant role in tramadol analgesic efficacy.
22399238 Following a single dose of pridopidine, the drug is N-depropylated by CYP2D6. Multiple repeat dosing studies suggest that CYP2D6 is at least partly inactivated by pridopidine.
22398969 A genetic model combining maternal risk genotypes in CYP2D6 and ABCB1 is significantly associated with the adverse outcomes of codeine toxicity in infants and their mothers.
22355045 results suggest that DEC2 periodically represses the promoter activity of CYP2D6, resulting in its circadian expression in serum-shocked cells
22324840 determined the frequency of functionally important allele variants of CYP2D6 gene in a sample of an Urban/admixed and five Amerindian Venezuelan populations.
22308038 structural flexibility that is likely to contribute to the catalytic versatility of P450 2D6
22303032 Genetic variants in CYP2D6 are associated with Ecstasy-induced hyponatraemia.
22301406 Lower CYP2D6*4 allele is associated with breast cancer.
22281720 Compared with the CYP2D6 wt/wt group, the area under the plasma concentration-time curve (AUC(0-infinity)) values for lovastatin lactone increased.
22281432 Data indicate that the CYP1A1 (val) "variant" genotype increased the risk of renal cell carcinoma (RCC), whereas, the CYP2D6 polymorphism did not show any association with RCC risk.
22277677 Report inter-individual variability of in vivo CYP2D6 activity in different genotypes.
22245658 The CYP2D6*10/*10 genotype has a significant impact on the plasma exposure of tamsulosin in healthy Koreans
22216145 CYP2D6 gene locus is heterogeneous in the UAE national population and no significant differences have been identified between the psychiatric patients and controls
22198443 Our results indicate that CYP2D6 genotype has no sufficient clinical impact that poor metabolizers and ultrarapid metabolizers are easily clinically identified with.
22180372 We report the identification of a novel and defective variant of the gene encoding cytochrome P450 2D6; it represents a rare subtype of CYP2D6*6 that may be restricted to a single family or a subpopulation.
22180068 distribution of CYP2D6*4 mutations in 249 patients from Tokat province in Turkey with symptoms of arthritis, sacroiliac, joint and back pain
22159753 Occupancy of substrates on two template areas is suggested to be essential for the metabolism of CYPD6 substrates.
22141351 CYP2D6 genetic polymorphism might be of use as a biomarker of death by suicide, which is in agreement with previous findings
22109568 The genotype distributions of CYP2D6 were not significantly different in the response group and the nonresponse group.
22092298 Methadone inhibits CYP2D6 ..... in vivo
22039821 Fifty four out of these 60 compounds could be docked into the active site of CYP2D6.
21989258 The novel humanization strategy described here provides a robust approach for the expression of different CYP2D6 allelic variants in transgenic mice.
21971440 Polymorphisms in CYP2D6 genes do not seem to be related to the occurrence of cognitive dysfunction after non-cardiac surgery in patients anesthetised with propofol.
21958961 The lower CYP2D6 levels in PD cases may have reduced their ability to inactivate Parkinson's disease-causing neurotoxins contributing to their disease risk.
21956465 an increased risk of breast cancer development in hereditary tainted patients with genotype *4*4 of CYP 2D6 gene compared to the control group has been revealed
21918425 CYP2D6 is responsible for the metabolism of most beta-blockers.
21913948 genetic association studies in ethnic Chinese populations: first report of interethnic differences (i.e., SNPs) in frequencies of functional CYP2D6 and CYP2C19 genes among Chinese Mongolian, Hui and Han populations
21907728 results indicate that the PON1 and CYP2D6 genotypes can modulate DNA damage elicited by some organophosphate pesticides possibly through gene-environment interactions
21880792 There was no association between any CYP2D6 metabolism parameter with breast cancer events in raloxifene-treated patients.
21861665 CYP2D6 was 18 polymorphisms and greater than 50% of the population carried polymorphisms in either two or all of the CYP2C9, CYP2C19 and CYP2D6 genes.
21860550 CYP2D6 polymorphisms may be not associated with the breast cancer development.
21840870 No associations were found with CYP2D6 and the risk of delayed chemotherapy-induced nausea and vomiting in patients treated with ondansetron and metoclopramide.
21835244 we confirmed a central nervous system effect of CYP2D6 activity in a large independent sample and provide evidence that basic cognitive processes related to such as alertness may be impacted
21826689 The prevalence of the commonly observed CYP2D6 and CYP2C19 alleles in the Hungarian population corresponds with that of other European populations.
21823108 No significant effect of CYP2D6 genotype on risk of recurrence in breast cancer patients who received adjuvant tamoxifen therapy.
21821735 CBD caused potent direct CYP2D6 inhibition, in which two phenolic hydroxyl groups and the pentyl side chain of CBD may play important roles.
21803659 This pilot study is unable to infer an association between CYP2D6 phenotype and galantamine responsiveness in patients with dementia.
21797939 CYP2D6*4-associated poor metabolizer status of the donor liver seems to have no influence on fibrosis progression after liver transplantation. Recipients, carrying the allele, have an elevated risk for an accelerated fibrosis progression.
21787170 CYP2D6 was the primary recombinant human CYP producing metabolites of berberine.
21749835 case report of polymorphism and neuroleptic malignant syndrome with risperidone
21743374 the extreme CYP2D6 genotypes (PMs and UMs) seemed to predict pain response and adverse events.
21728792 CYP2D6 genotyping in natives and immigrants from the Emilia-Romagna Region (Italy).
21677335 Promoter variations -1822A-->G and -1740C-->T are present only in hepatitis C infected subjects. Hepatitis C positive individuals were associated with a lower liver CYP2D6 enzyme activity.
21631295 The result of the present study showed that CYP2D6*4 is the major nonfunctional allele found in Mazandarani subjects.
21605066 we tested known probe substrate for these enzymes, which included 12 substrates of CYP3A4 and 18 substrates of CYP2C9 and CYP2D6 were analyzed by each software and the results were compared.
21599570 There were significant CYP2D6 allele-specific differences in carvedilol pharmacokinetics, but the CYP2D6 genotype had no effect on heart rate, blood pressure or adverse effects.
21596874 In a postoperative setting, genetically and environmentally determined CYP2D6 and CYP3A enzyme activity might have implications for antiemetic efficacy.
21589866 the genetic polymorphisms of CYP3A5, CYP2B6, CYP2C9, CYP2C19, and ABCB1 examined did not influence methadone dosage. A small influence of CYP2D6 genetic polymorphism in methadone doses and plasma concentrations was found.
21543662 The adverse events associated with amoxetine administration reported by CYP2D6*10/*10 subjects were indistinguishable from those of other Japanese participants.
21527579 Single Nucleotide Polymorphism in CYP2D6 gene is not associated with breast cancer.
21518482 CYP2D6 (rs16947) and GSTO2 (rs156697) polymorphisms are independent factors influencing complete remission rates of the first induction chemotherapy in de novo AML patients.
21486104 The risk of developing opioid dependence may be lower in individuals who are rapid metabolizers due to variation in the CYP2D6 gene .
21485696 Evaluate a long-PCR procedure for detecting CYP2D6 gene duplication.
21456632 Report MDMA-induced mechanism-based inhibition of CYP2D6 in women.
21449914 The peak serum concentration and area under the serum concentration-time curves were significantly different among the ABCB1 3435C>T genotypes in CYP2D6*10/*10.
21437611 Polymorphisms of CYP2D6 were not associated with clinical outcomes in early breast cancer (EBC) patients receiving adjuvant tamoxifen treatment.
21433154 Harmine, harmaline, harmol and harmane exhibited noncompetitive inhibition on the activity of CYP2D6.
21430657 Women with an impaired CYP2D6 metabolizer phenotype for tamoxifen serum concentration are more likely to be in the bottom quintile of breast cancer survivors using tamoxifen, as compared with the mean for the patient cohort as a whole.
21391885 This first comprehensive resequencing analysis of CYP2D6 in Mexican Mestizos provides information about genetic diversity relevant to the development of pharmacogenomics in the Latin American population.
21321564 The present study shows that CYP2D6 ultrarapid metabolizers among eating disorders have a greater risk of engaging in suicidal behavior.
21248727 the study supports the hypothesis that CYP2D6 duplication genotype has a specific effect on suicidality in patients experiencing a depressive episode of either the unipolar or bipolar variety
21241245 A breast-fed infant succumbed to fatal opioid intoxication because the codeine-prescribed mother had more than 2 copies of CYP2D6 ultrarapid metabolism phenotype, thus exposing the infant to a higher production of morphine levels.
21173786 Despite not knowing patients' CYP2D6 genotype, clinicians intuitively modify risperidone dosage in order to obtain the best therapeutic option.
21140323 A molecular-genetic investigation showed a duplication in the CYP2D6 gene. This genetic situation caused a quick metabolizing-status for substances dependent on CYP2D6 like Tramadol, which is a prodrug.
21135868 variability in CYP2D6 phenotypes found may be related to differences in allele frequency among groups (that is, CYP2D6*10 and *17 highest in Nicaratuan Mestizos and Cuban Mestizos
21108610 CYP2C9*2, CYP2C19*2, and CYP2D6*4 polymorphisms do not appear to play a role in type 2 diabetes mellitus
21072184 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21071160 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
21063774 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20970553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20925579 patients with rs16947 CT (P(1/4)0.043) or TT (P(1/4)0.043) were more inclined to bradycardia than those with rs16947 CC
20925579 Observational study of gene-disease association. (HuGE Navigator)
20881950 CYP2D6 genotype and, to a lesser degree, urine pH contribute to the variability in pharmacokinetic profiles of dextromethorphan.
20881950 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20878561 Genetic polymorphisms of CYP2D6 is not associated with gastric carcinoma.
20878561 Observational study of gene-disease association. (HuGE Navigator)
20877302 present findings suggest an association between CYP2D6 and eating disorders (ED). CYP2D6 allele distribution in patients with ED seems related to increased enzyme activity
20877302 Observational study of gene-disease association. (HuGE Navigator)
20877299 Authors conducted a systematic review and meta-analyses to consider whether testing for CYP450 single nucleotide polymorphisms in adults starting antipsychotic treatment for schizophrenia predicts and leads to improvements in clinical outcomes.
20877299 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20863179 Observational study of genetic testing. (HuGE Navigator)
20859244 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20857895 Observational study of gene-disease association. (HuGE Navigator)
20851451 biomarker of susceptibility to manganese toxicity
20851451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20849243 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20846929 The most important cytochrome P450 enzymes, CYP2D6*4 and CYP2D6*41 cause abolished and reduced CYP2D6 activity, respectively, and CYP3A5* 3 and CYP3A5*5 , common in Caucasian populations, which cause almost null activity.
20828547 Observational study of genetic testing. (HuGE Navigator)
20827267 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20814331 In this study six major CYP2D6 polymorphisms are detected (CYP2D6*3,*4,*5,*6,*7, and *9) which influence the pharmacokinetics of risperidone in healthy volunteers.
20814331 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20809362 Data support association between CYP2D6 polymorphisms and clinical outcome in tamoxifen treated breast cancer patients and note the adverse effect of poor adherence.
20809362 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20799519 Puerto Ricans exhibit distinct CYP2D6 allele frequencies and harbor a non-functional allele that is rare or absent in other populations
20799519 Observational study of gene-disease association. (HuGE Navigator)
20731819 Data show that CYP2D6*6 may affect BCSS in tamoxifen-treated patients.
20731819 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20727252 This study suggested that efficient meth metabolism dependent on the activity of cytochrome P450-2D6 (CYP2D6)is associated with worse neurocognitive outcomes in humans.
20727252 Observational study of gene-disease association. (HuGE Navigator)
20701904 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20700584 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20686235 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20684753 Polymorphisms in CYP2D6 is not associated with drug sensitivity in patients with Multiple Myeloma.
20684753 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20656072 Data show that CYP2A6 and CYP1A2 have the least malleable active sites while those of CYP2D6, CYP2C9 and CYP3A4 have considerably greater degrees of flexibility or malleability.
20656020 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20643254 Polymorphisms in CYP2D6 were not associated with a response to metoprolol or carvedilol therapy in our cohort of patients with heart failure. The ADRB1 and CYP2D6 genotype, alone and in haplotype, were significantly associated with the dose of carvedilol.
20643254 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628863 Only NAT1 showed a significant lower DNA methylation rate in the control group than in the tamoxifen-resistant breast cancer group, and no significant difference in methylation was found in COMT, CYP1A1, CYP2D6, and SULT1A1 genes.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20599499 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20597905 Observational study of gene-disease association. (HuGE Navigator)
20590588 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20590587 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20588073 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574415 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20565970 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20563569 Our findings suggest that CYP2D6 and ABCB1 G2677T and C3435T may be useful determinants of risperidone plasma concentrations
20563569 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20547595 CYP2D6 genotype and smoking status explained the variance in fluvoxamine concentration in Japanese psychiatric patients.
20547595 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20531370 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20530222 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20520586 High levels of genetic variation at CYP2D6, a locus coding for a detoxifying enzyme of the cytochrome P450 complex, reflect this change.
20515869 Data suggest that broad CYP2D6 allele coverage is recommended to reduce phenotype misclassification for tamoxifen pharmacogenetics.
20515869 Observational study of gene-disease association, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20492431 Observational study of gene-disease association. (HuGE Navigator)
20489028 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20473659 CYP2D6 31 was associated with poor metabolism of dextromethorphan in vivo, consistently with a previous report classifying this allelic variant as nonfunctional.
20473659 Observational study of gene-disease association. (HuGE Navigator)
20467479 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20461808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20459744 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20456744 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20454926 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20435235 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20432045 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20430047 Observational study of gene-disease association. (HuGE Navigator)
20421845 The aim of this study was to identify copy number variations assays that can differentiate between multiple copies of the CYP2D6*36 allele and multiple copies of other CYP2D6 alleles.
20385997 This observational study did not show an association between concomitant CYP2D6 inhibitor use and breast cancer recurrence among patients treated with adjuvant tamoxifen.
20375710 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373852 Observational study of gene-disease association. (HuGE Navigator)
20368706 This study demonistrated that CYP2D6 have functional role in the brain.
20368706 Observational study of gene-disease association. (HuGE Navigator)
20364044 cases carrying combination of heterozygous genotypes of CYP2D6*4 or CYP2D6*10A(188C > T) and NAT2*5 were of significantly higher risk for Parkinson disease (PD) demonstrating the importance of gene-gene interactions in determining susceptibility to PD
20364044 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20350136 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20335142 The CYP2D6 gene mutation is associated with a high risk of heroin spongiform leucoencephalopathy.
20335142 Observational study of gene-disease association. (HuGE Navigator)
20332423 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20309015 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20305604 Polymorphisms of CYP2D6 enzyme through which most psychotropic drugs are metabolized and TaqIA DRD2 which is target for antipsychotic drugs could be the link between pharmacogenetic factors and potential for development of MNS.
20297661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20225176 The molecular genetic investigation revealed a compound heterozygous mutation in the CYP2D6 gene and thus documented a genetic predisposition as a "poor [non]metabolizer".
20206139 Effects of CYP2D6 status on 5-methoxy-N,N-dimethyltryptamine metabolism and pharmacokinetics are reported.
20205348 There seems to be little allele heterogeneity in CYP2D6 amongst different European populations (e.g., amongst different Spanish populations) that have shown diversity in other loci.
20205348 Observational study of genotype prevalence. (HuGE Navigator)
20201714 We did not find a statistically significant difference in the frequency of CYP2D6 alleles between oral lichen planus patients and healthy controls
20201714 Observational study of gene-disease association. (HuGE Navigator)
20195825 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20185366 An apparent association between number of active cytochrome P450 2D6 alleles and multiple chemical sensitivity status was not statistically significant.
20185366 Observational study of gene-disease association. (HuGE Navigator)
20174590 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20147896 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20137387 Genotypes of CYP2B6, GSTP1 and CYP2D6 are related to susceptibility to the metabolism of styrene in human.
20136364 Observational study of genetic testing. (HuGE Navigator)
20133509 CYP3A5 but not CYP2D6 polymorphisms appear to exert a significant influence on dextropropoxyphene disposition.
20124171 CYP2D6 polymorphism is an important predictor for the prognosis of patients with breast cancer treated with tamoxifen.
20118554 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20081063 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20075642 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20041956 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20031551 Observational study of gene-disease association. (HuGE Navigator)
20009880 CYP2D6 gene polymorphisms are not associated with cervical cancer.
20009880 Observational study of gene-disease association. (HuGE Navigator)
20007670 CYP2D6 was confirmed as the major high-affinity isoform contributing to paroxetine metabolism to catechol derivative.
19997080 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19995332 Although the ratio of individual metabolites produced in Tg-CYP2D6 MLM was closer to that in human CYP2D6 extensive metabolizer liver microsomes, the urinary DMI metabolic profiles did not show much difference between wild-type and Tg-CYP2D6 mice.
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19954746 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19954080 Compared to other populations that have been amply studied, Puerto Ricans may have relatively fewer inactive alleles and relatively more reduced-activity alleles
19953095 The evaluated single nucleotide polymorphism in CYP2D6 did not seem to influence bone marrow density in tamoxifen-treated subjects with breast cancer.
19953095 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19947517 Observational study of gene-disease association. (HuGE Navigator)
19946748 no statistically significant association was found between CYP2D6*4, CYP3A5*3 and ABCB1 3435T polymorphisms and drug-related falls
19946748 Observational study of gene-disease association. (HuGE Navigator)
19940985 Formation of the codeine metabolites was dependent on the CYP2D6 genotype in hemodialysis patients with end-stage renal disease.
19940985 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19937844 Ligand-based QSAR models have been developed using a novel modeling approach, and provide probabilities of being a target of CYP3A4 or CYP2D6 for any atom in a molecule
19910717 CYP2D6 genotype significantly affects the steady-state serum concentrations of risperidone and 9-hydroxyrisperidone in patients using injectable long-acting risperidone.
19910717 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19907421 Observational study of gene-disease association. (HuGE Navigator)
19902987 further prospective studies on the clinical impact of CYP2D6-dependent metabolism of drugs are warranted in large cohorts--REVIEWE
19892789 The frequencies of phase I wild-type genotypes of CYP1A1 and CYP2D6 in recurrent miscarriage cases were 0.56 and 0.60, whereas in controls these were 0.68 and 0.65, respectively.
19892789 Observational study of gene-disease association. (HuGE Navigator)
19891553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19887477 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19866496 Reduced-activity alleles of CYP2D6 is associated with tamoxifen metabolism in breast cancer.
19840783 the influence of CYP2C19 and CYP2D6 in the disposition of citalopram
19840783 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19833260 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19823875 Studies indicate that of the 200 most clinically used drugs, 73% require metabolism and 72% of the enzymes responsible are members of the P450 superfamily, predominantly CYP3A4, CYP2D6, CYP2C19, CYP2C9, and CYP1A2.
19809024 the presence of 2 functional CYP2D6 alleles was associated with better clinical outcomes among women with breast cancer treated with tamoxifen.
19809024 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19797609 results are in agreement with the large and flexible active site of CYP3A4 and the more restricted active site of CYP2D6
19781968 Studies indicate that CYP2D6 has been identified in the mitochondria of liver samples and found that it is metabolically active in this novel location.
19761369 CYP2D6 poor metabolizer genotype seems not to be a determining factor of schizophrenia susceptibility in Brazilians
19761369 Observational study of gene-disease association. (HuGE Navigator)
19738170 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19719813 Oxycodone is metabolized to its active metabolite oxymorphone by O-demethylation via polymorphic CYP2D6. Oxymorphone formation depends on CYP2D6, but no difference was found in the post-operative analgesic effect of oxycodone between CYP2D6 genotypes.
19719813 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19715474 Observational study of gene-disease association. (HuGE Navigator)
19710642 Escitalopram is a weak inhibitor of the CYP2D6-catalyzed O-demethylation of (+)-tramadol but does not reduce the hypoalgesic effect in experimental pain.
19710640 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19702490 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19694742 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19660006 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19656108 In pregnant women with chronic arterial hypertension receiving antihypertensive therapy with bisoprolol and nifedipine polymorphic marker CYP2D6 of CYP2D6 gene is not associated with prognostically unfavorable hemodynamic changes.
19656108 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19652678 CYP2D6 genetic polymorphisms found in over 10% of patients prescribed risperidone for the treatment of psychosis
19636337 In CYP2D6, we identified 84 different polymorphisms, including 18 novel single-nucleotide polymorphisms in Han Chinese. One novel polymorphism is located in a potential cis-regulatory element of the gene.
19636337 Observational study of genotype prevalence. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19604091 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19604084 Poor metabolizers of CYP2D6 versus extensive metabolizers show lower vulnerability to psychopathology and greater impulsivity.
19604081 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19597703 Our findings do show CYP2D6*4/*4 carriers to have activity of tamoxifen on breast cancer, endometrium and serum levels of follicle-stimulating hormone and sex hormone-binding globulin
19597703 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19596663 the CYP2D6*10 genotype is unlikely to have any clinical significance for prognosis of node-negative Japanese breast cancer patients receiving adjuvant tamoxifen alone
19596663 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593802 CYP2D6 polymorphism variants were associated with an increased risk of acute lymphoblastic leukemia
19593802 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19593180 The ratio of O-desmethylvenlafaxine/venlafaxine is an effective means of phenotyping individuals according to their CYP2D6 metabolizer status.
19593168 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593158 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19575027 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19537956 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19523031 CYP2D6 ultrarapid metabolizers may have higher efficiency in synthesizing endogenous morphine compared with other metabolizers
19523031 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19521114 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19474452 Observational study of genetic testing. (HuGE Navigator)
19470220 Biotechnological synthesis of the designer drug metabolite 4'-hydroxymethyl-alpha-pyrrolidinohexanophenone in fission yeast heterologously expressing human cytochrome P450 2D6--a versatile alternative to multistep chemical synthesis.
19448135 CYP2C9-CYP2D6 interactions can alter catalytic activity and, thus, influence in vitro-in vivo correlation predictions.
19444434 the CYP2D6*4 mutation has the effect of increasing systemic sclerosis morbidity rate
19438707 Results suggest that the targeting of CYP2D6 to mitochondria could be an important physiological process that has significance in xenobiotic metabolism.
19437119 This data also showed no overall statistically significant association between alleles and incidence risk of inflammatory bowel disease [odds ratio (OR) of 1.36 for CYP2D6*1 allele, 0.83 for CYP2D6*3 allele, and 0.74 for CYP2D6*4 allele].
19429471 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19421167 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19405050 The frequencies obtained for the non-functional alleles and for the CYP2D6 gene duplication are in agreement with other South European populations.
19405050 Observational study of genotype prevalence. (HuGE Navigator)
19395173 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19387994 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19387424 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19374513 CYP2D6 gene is not related to a predisposition to depression or anxiety disorders in the elderly.
19374513 Observational study of gene-disease association. (HuGE Navigator)
19365402 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19364831 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19357842 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19356055 women with cervical intraepithelial neoplasia I/II (CIN I/ CIN II) and CYP2D6 EM genotype who smoke appears to have more chances for the lesions to progress to CIN III
19350405 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19330589 Observational study of genotype prevalence. (HuGE Navigator)
19320528 Pharmacogenetic diagnostics may be an important factor in individualizing drug treatment according CYP2D6 genotype
19308365 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19303860 Observational study of genetic testing. (HuGE Navigator)
19296901 Observational study of genetic testing. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19284319 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19242697 No significant risk of Turkish ankylosing spondylitis development was observed for individuals with one or two CYP2D6*4 alleles.
19242697 Observational study of gene-disease association. (HuGE Navigator)
19225771 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19219857 Observational study of gene-disease association. (HuGE Navigator)
19194367 Decreases in CYP2D6 activity, either by inactivating polymorphisms or drug interactions, can reduce concentrations of tamoxifen's active metabolites.
19192051 Observational study of gene-disease association. (HuGE Navigator)
19189212 The risk of breast cancer mortality is increased in tamoxifen users with decreased CYP2D6 activity, consistent with the model in which endoxifen formation is dependent on CYP2D6 activity.
19189212 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19189210 In breast cancer, patients treated with adjuvant tamoxifen, non-functional and severely impaired CYP2D6 variants are associated with a worse DFS and with a higher frequency of severe and mild toxicities
19189210 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169185 Observational study of gene-disease association. (HuGE Navigator)
19164093 Observational study of genotype prevalence. (HuGE Navigator)
19162321 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19156902 the CYP2D6 10/10 genotype is not likely to have a clinically significant impact on prognosis, endometrial thickness, BMD, or total cholesterol levels in Japanese patients with breast cancer who are treated with adjuvant tamoxifen.
19156902 Observational study of gene-disease association. (HuGE Navigator)
19153830 CYP2D6 activity may be a modest predictive factor for tamoxifen-induced hot flashes.
19153830 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19151603 Pharmacogenetic variation at CYP2D6 in different population groups
19142106 P450 2D6 genetic polymorphisms had no discernible impact on exposure to desvenlafaxine. Compared with an EM phenotype, a PM phenotype had a significant effect on venlafaxine and desvenlafaxine plasma concentrations after venlafaxine ER administration.
19142106 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19095219 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19094446 Knowledge of the combination of CYP2D6 and beta(1) adrenoreceptor polymorphisms may be used to guide antihypertensive therapy using beta(1) adrenoreceptor antagonists.
19094446 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19082882 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19071885 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19047159 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19037197 After administration of metoprolol, plasma concentrations of the drug are markedly higher in CYP2D6 poor metabolizers compared to controls; CYP2D6 genotype contributes to interindividual differences in metoprolol response.
19033450 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19032724 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19025845 Observational study of gene-disease association. (HuGE Navigator)
19024387 C188/C, C188/T, G4268/G and G4268/C genotype of CYP2D6 was correlated with increased risk of lung cancer.
19024387 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
19001559 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19000940 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19000552 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18979093 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18978520 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18958918 Observational study of genotype prevalence. (HuGE Navigator)
18927241 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18840375 this study was to assess the activities of cytochrome P450 (CYP) 1A2, N-acetyltransferase 2, xanthine oxidase, and CYP2D6 in children with isolated idiopathic GH deficiency before and 3 and 6 months after initiation of r-hGH treatment.
18834373 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18827765 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18797858 Identification of a novel non-functional CYP2D6 allele, CYP2D6*69, in a Caucasian poor metabolizer individual. (Case Report)
18794105 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18794098 An index composed of inherited (CYP2D6) and tumor (HOXB13/IL17BR) gene variation identifies patients with varying degrees of resistance to tamoxifen.
18794098 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18784654 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18784265 Functional characterization of 17 CYP2D6 variants detected in Japanese individuals revealed an absence of enzyme activity in four variants, low activity in eight, and high activity in one, compared with the wild type.
18754843 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18728242 [13C]-dextromethorphan breath test may provide rapid phenotyping assay for CYP2D6 activity.
18725510 The CYP2D6 pharmacophore and characteristic features in the active site cavity suggest a favored substrate orientation that prevents N-dealkylation from occurring.
18719619 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18713907 a CYP2D6 gene duplication may result in ultra-rapid metabolism of tramadol to its active metabolite (+)O-desmethyltramadol [case report]
18708991 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18698000 anandamide may be a physiological substrate for brain mitochondrial CYP2D6.
18690546 no association with bladder cancer found
18690546 Observational study of gene-disease association. (HuGE Navigator)
18681789 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18666237 Human subjects with the HNF4A G60D genotype tended to have lower CYP2D6 activity than those with the wild-type HNF4A. The HNF4A G60D variant was detected at low frequency in Asian populations and was not found in Africans or Caucasians.
18663559 Hypothetically, cytochrome P450 2D6 influences the transport of taurine across the blood-brain barrier.
18648788 Metoprolol disposition and effects are mainly controlled by CYP2D6 genotype.
18641553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18632250 This is the first large-scale study to analyze polymorphisms systematically across the whole CYP2D6 gene in the Chinese Han population; forty-eight different polymorphisms were detected as well as 12 novel ones.
18632250 Observational study of genotype prevalence. (HuGE Navigator)
18625943 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18618215 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18597648 Relatioship between personality traits and CYP2D6 genotypes has been evaluated.
18597648 Observational study of gene-disease association. (HuGE Navigator)
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18553077 Semi-quantitative CYP2D6 gene doses in relation to metabolic ratios of psychotropics are reported.
18551040 Observational study of gene-disease association. (HuGE Navigator)
18547414 Observational study of genetic testing. (HuGE Navigator)
18545991 Enantiospecific pharmacokinetics of metropolol in CYP2D6 ultra-rapid metabolizers and correlation with exercise-induced heart rate are reported.
18545991 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18543297 Metabolism of dextrorphan by CYP2D6 in different recombinantly expressed systems and its implications for the in vitro assessment of dextromethorphan metabolism.
18520597 the impact of the CYP2D6 polymorphism on the pharmacokinetics of tramadol was clearly demonstrated in a group of multimedicated patients treated with tramadol
18520597 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18520596 no significant associations between the CYP2D6 genotype and suicidal behavior or substance abuse disorder were noted
18520596 Observational study of gene-disease association. (HuGE Navigator)
18480698 Because ARI displays high affinity for 5-HTR2A AND D2 receptors and CYD2D6 is involved in its metabolism, polymorphisms were analyzed.
18474679 results suggest that age and genetic determinants of CYP2D6 expression constitute significant determinants of interindividual variability in CYP2D6-dependent metabolism during ontogeny
18474629 Transgenic mice expressing the identical human CYP2D6 protein in the liver, indicate the presence of stronger immunological tolerance.
18445827 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18433425 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18429752 In patients having in genotype Pro allele of polymorphic marker Pro34Ser of CYP2D6 gene therapy with betaxolol is more effective, than in homozygote carriers of Ser allele.
18425996 We identified the null variants *3,*4,*5,*6,*7 and *8 of the CYP2D6 gene [encoding for cytochrome P450 (debrisoquine hydroxylase)] in a group of 84 chronic-stay psychiatric inpatients with severe schizophrenia
18425996 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18425152 Observational study of genotype prevalence. (HuGE Navigator)
18423013 Polymorphisms of some XME genes may predict the onset of breast carcinoma as well as survival after treatment.A significant association was found between CYP2D6 (G/G) wild type and breast carcinoma risk only in postmenopausal patients.
18423013 Observational study of gene-disease association. (HuGE Navigator)
18414197 Genetic polymorphisms of metabolic enzymes CYP1A1, CYP2D6, GSTM1 and GSTT1 and leukemia susceptibility.
18414197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18407954 The serum 4OHtam concentrations were significantly lower in breast cancer patients with the CYP2D6 *10 homozygous variant T/T genotype than in those with the homozygous wild-type C/C genotype.
18407954 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18401578 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18384443 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18382661 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18372530 CYP2D6 gene may not only increase the risk for bladder cancer among Egyptians, but may also influence the clinicopathological tumor outcome.
18372530 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18346782 analysis of 3D-models for CYP2D6 and for its complexes with ajmalicine and quinidine
18346175 The CYP2D6 genotype may be a contributory factor in the development of extrapyramidal side-effects in patients undergoing antipsychotic therapy.
18346175 Observational study of gene-disease association. (HuGE Navigator)
18327668 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18317231 Postmenstrual age and CYP2D6 polymorphisms determine tramadol o-demethylation in critically ill neonates and infants.
18317231 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18304900 The frequency of CYP2D6*4 allele, was observed in 8.25% of healthy volunteers and in 10.62% of patients. CYP2D6*4/CYP2D6*4 was absent in cases. In all group of patients, the CYP2D6*4 allele did not appear to influence bladder cancer susceptibility.
18304900 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18300942 This study does not support an association between Parkinson's disease and mutations of the CYP2D6 and HFE genes.
18300942 Observational study of gene-disease association. (HuGE Navigator)
18294285 Observational study of gene-disease association. (HuGE Navigator)
18287869 studied the association of polymorphisms of cytochrome P450 (CYP-4501A1*2A, *2B, *2C and *4 alleles, CYP-4502D6*4 allele), GSTM1 and GSTT1 null genotypes, and NAT2*6B and *7A alleles with the incidence of AML in an eastern Indian population
18287869 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18280655 present study demonstrated that reduced CYP2D6 activity was a negative risk factor for methamphetamine dependence.
18280655 Observational study of gene-disease association. (HuGE Navigator)
18261353 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18258609 Observational study of gene-disease association. (HuGE Navigator)
18240905 CYP2D6 genotype frequency in the American Jewish population (8.8%) was approximately twofold higher than that in other North American Caucasians.
18240905 Observational study of genotype prevalence. (HuGE Navigator)
18231117 Observational study of gene-disease association. (HuGE Navigator)
18223460 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18214849 Adverse herb-drug interactions may result with concomitant ingestion of goldenseal supplements and drugs that are CYP2D6 substrates.
18214456 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18211048 QSAR analysis for substrate specificity of six CYP isoforms, revealing that CYP2C9 substrates are anionic compounds, while CYP2D6 substrates are cationic, and CYP2E1 substrates are smaller compounds, while CYP3A4 substrates are larger compounds
18204346 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18202841 Observational study of genotype prevalence. (HuGE Navigator)
18197300 Genetic polymorphisms in CYP2D6 genes were significant predictors of both baseline and postshowering blood trihalomethane (THM) concentrations as well as of changes in THM concentrations associated with showering
18183034 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18167502 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18165569 A continuous epidural infusion of ropivacaine inhibits CYP2D6 activity in patients who are extensive metabolizers resulting in a twofold increase in the metabolic ratio for debrisoquine hydroxylation.
18086475 Possible genes for antipsychotic treatment response were the dopamine D2 receptor gene (DRD2), the serotonin 2A and 2C receptor genes (HTR2A and HTR2C), the P-glycoprotein gene (ABCB1 or MDR1) and the drug-metabolizing cytochrome P450 2D6 gene (CYP2D6).
18086475 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18075468 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18070221 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18061941 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18048313 there are four SNPs in CYP2D6 that exhibit radical changes in amino acid properties which may cause a lack of functionality in the CYP2D6 gene and contribute to a person's inability to metabolise specific drugs
18034624 CYP2D6 polymorphism may influence, not only variability to drug response, but also vulnerability to disease in schizophrenia patients (review).
18024866 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17992535 The genotypes of CYP2C19 and of CYP2D6 were examined. An association of the metabolic phenotype with genetic disposition was observed.
17992535 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17971818 Observational study of gene-disease association. (HuGE Navigator)
17971818 Evaluate activity score as a tool for translating CYP2D6 genotype into a qualitative measure of phenotype.
17966194 Observational study of gene-disease association. (HuGE Navigator)
17965522 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17965519 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17965519 Suggest that the CYP2D6*41 allele significantly affects drug-metabolizing activity and aripiprazole pharmacokinetics.
17957765 the major metabolites formed by the P450 BM3 mutants differ from those formed by human cytochrome P450 2D6.
17947222 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17921051 Our retrospective analysis reveals that a decrease of REM sleep under tolterodine is found only in individuals carrying one or two deficient CYP2D6 alleles.
17909762 Observational study of genetic testing. (HuGE Navigator)
17908053 The presence of the APOE-4 allele and CYP2D6 genotype to deteriorate the cholinesterase inhibitors therapeutic outcome in Alzheimer's disease.
17882159 A priori knowledge of the pharmacogenetic variation known to abrogate CYP2D6 enzyme activity may provide a means by which the hormonal therapy of breast cancer can be individualized.
17828532 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17803873 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17803873 Genetic variations of the P450 2D6 gene may contribute to patient-specific variation in response to treatment with venlafaxine.
17764479 A high proportion of CYP2D6 PMs was found in a Faroese patient group medicated with AT.
17764479 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17761971 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17761971 CYP2D6*10/*10 is associated with lower steady-state plasma concentrations of active tamoxifen metabolites, which could possibly influence the clinical outcome by tamoxifen in Asian breast cancer patients.
17725248 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17725248 The CYP2D6 genotype is not a major determinant of (R)-, (S)-, or racemic-methadone oral clearance.
17715206 Observational study of gene-disease association. (HuGE Navigator)
17714084 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
17713466 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17701031 Observational study of gene-disease association. (HuGE Navigator)
17701031 Our findings suggest that the CYP2D6*5 allele is likely to affect vulnerability to development of neuroleptic malignant syndrome
17700359 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17700359 results suggest that the CYP2D6*4 allele is associated with broadly related muscle events caused by at least two structurally dissimilar HMG-CoA reductase inhibitors
17697394 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17667959 CYP2c19 and CYP2d6 genotypes can be used to predict imipramine+desipramine plasma levels in in depressed patients.
17667959 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17667795 The authors found a clear correlation between haloperidol plasma concentration and number of active CYP2D6 alleles. No correlation was found between plasma concentration of haloperidol or number of CYP2D6 alleles and treatment outcome or side effects.
17635183 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17635181 Observational study of genotype prevalence. (HuGE Navigator)
17624022 Organic amines that score highly as being druglike, based on a Bayesian model constructed using a 5223-drug training set, are least likely to bind to CYP2D6.
17610534 Homozygous CYP2D6*10 subjects had 50% lower clearances compared with other EM subjects, resulting in twofold higher mean exposures.
17610534 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17609736 Tramadol disposition can be used as a probe to assess CYP2D6/CYP3A4 ontogeny in the first months of life.
17581325 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17581325 This case-control study suggests a contribution of CYP2D6 and GSTM1 null variants in the development of acute leukaemia. In addition, GSTM1 and GSTT1 genotypes were apparently related to response, side effects and prognosis of patients with AML.
17573783 Leukocyte exposure to morphine down-regulated catechol-O-methyl transferase (COMT) and CYP2D6 by approximately 50% compared with control values.
17570739 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17570739 CYP2D6 activity may play an important role in determining the pharmacokinetics of tramadol and in predicting its adverse effects.
17568504 Observational study of genotype prevalence. (HuGE Navigator)
17554527 Observational study of genetic testing. (HuGE Navigator)
17547692 Observational study of gene-disease association. (HuGE Navigator)
17547692 Results suggest poor metaboliser genotype could have a protective effect against PTC. This could be explained by a role of CYP2D6 on the metabolic activation of putative environmental chemical thyroid carcinogens or by linkage to a cancer-causing gene.
17541883 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17536768 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17536768 Risk of ill health attributed to organophosphate-containing sheep dip is associated with PON1 genotype and phenotype varied with CYP2D6 and GSTP1 genotype but not consistently with a priori hypotheses
17530572 Observational study of genotype prevalence, gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17530572 CYP2D6 polymorphism does not seem to be a factor predisposing to Alzheimer's or Parkinson's diseases with dementia.
17517247 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17503978 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17479406 Observational study of gene-disease association. (HuGE Navigator)
17479406 The data suggested that individuals with CYP1A1 c.5639 T/T, CYP2D6 c.188 C/C, C/T, and CYP2D6 c.4268 C/C genotypes tend to be more susceptible to benzene toxicity.
17470523 The relative catalytic activities of three functionally active human CYP2D6 allelic variants, CYP2D6.1, CYP2D6.10, and CYP2D6.17, were investigated for their ability to metabolize drugs, and for the effects of CYP2D6-inhibitors on these three variants.
17460029 The newly identified variant CYP2D6*62 (g.4044C>T; R441C) had no activity toward propafenone as a result of missing heme incorporation.
17454842 Observational study of genetic testing. (HuGE Navigator)
17450472 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17449559 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17442289 Observational study of gene-disease association. (HuGE Navigator)
17431033 CYP2D6 metabolizes timolol, mainly by hydroxylation.
17418993 An inhibition assay was developed and validated for CYP2D6 in liver microsomes.
17392730 Observational study of genotype prevalence. (HuGE Navigator)
17374963 Observational study of genotype prevalence. (HuGE Navigator)
17361124 CYP2D6 genotype determined concentrations of O-desmethyltramadol enantiomers and influenced efficacy of tramadol treatment.
17329852 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17325735 Observational study of gene-disease association. (HuGE Navigator)
17325735 Shows lower frequency of CYP2D6 poor metabolizers in schizophrenic patients supporting the hypothesis of a potential role of CYP2D6 in the vulnerability to schizophrenia.
17324244 Observational study of gene-disease association. (HuGE Navigator)
17324244 no significant association between CYP2D6 activity and personality trait because of the small interindividual variability in CYP2D6 activity within the Japanese population
17311358 The frequencies of functional variant alleles of CYP2D6 in the Czech population are in concordance with other Caucasian populations.
17311358 Observational study of genotype prevalence. (HuGE Navigator)
17304721 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17301689 Observational study of genotype prevalence. (HuGE Navigator)
17301689 CYP2D6 diversity is far greater within than between populations and groups thereof, (ii) null or low-activity variants occur at high frequencies in various areas of the world, (iii) linkage disequilibrium is lowest in Africa and highest in the Americas.
17297618 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17289397 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17270484 Observational study of gene-disease association. (HuGE Navigator)
17259947 Duplications and multiplications of active CYP2D6 genes can cause ultrarapid drug metabolism and lead to therapeutic failure or unwanted side effects.
17250723 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17244352 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17242628 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17241532 Allelic distributions of the CYP2D6 gene copy number variation differ among Chinese from different regions, indicating ethnic variety in Chinese.
17241532 Observational study of genotype prevalence. (HuGE Navigator)
17234366 Observational study of gene-disease association. (HuGE Navigator)
17225875 Observational study of gene-disease association. (HuGE Navigator)
17225875 Results indicated that the CYP2D6*3 and CYP2D6*4 alleles, in particular, would be linked to the onset of porphyrias.
17224713 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17194620 Observational study of genotype prevalence. (HuGE Navigator)
17186005 Observational study of gene-disease association. (HuGE Navigator)
17178267 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17115111 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17113562 Observational study of genotype prevalence. (HuGE Navigator)
17102541 Observational study of gene-disease association. (HuGE Navigator)
17089107 Observational study of gene-disease association. (HuGE Navigator)
17089107 Results show that the occurrence of hypersomnia increased as the number of CYP2D6 mutant alleles increased.
17038884 Observational study of genetic testing. (HuGE Navigator)
16960721 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16924387 Observational study of genotype prevalence. (HuGE Navigator)
16880622 Observational study of genotype prevalence. (HuGE Navigator)
16864175 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16858124 Data provide additional information to the CYP2D6 sequence data that was obtained by the human genome project.
16855473 Data reported here is said to not support previously reported association between CYP2D6 genotype and personality trains using NEO Five-Factor Inventory.
16849011 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16845507 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16835697 Observational study of gene-disease association. (HuGE Navigator)
16835697 A significant association of 2850C > T (P = 0.015)of CYP2D6 with generalized tonic clonic seizures
16833023 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16819548 CYP2D6 genotypes predicting ultrarapid metabolism resulted in about 50% higher plasma concentrations of morphine and its glucuronides compared with the extensive metabolizers.
16815318 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16812949 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16778723 Observational study of genotype prevalence, gene-disease association, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16775389 Observational study of gene-disease association. (HuGE Navigator)
16771603 Observational study of genotype prevalence. (HuGE Navigator)
16716118 Observational study of gene-disease association. (HuGE Navigator)
16679388 Base sequence from commercial human hepatocytes - potential to identify and characterize dysfunctional alleles and their likely mechanisms affecting gene expression
16642541 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16638864 Observational study of gene-disease association. (HuGE Navigator)
16638736 Observational study of genotype prevalence. (HuGE Navigator)
16633141 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16633140 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16611538 Observational study of gene-disease association. (HuGE Navigator)
16595916 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16584388 Observational study of gene-disease association. (HuGE Navigator)
16584388 CYP2D6 genotype might be a significant predictor of liver fibrosis progression rate in chronic hepatitis C patients.
16551910 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16550211 Observational study of gene-disease association. (HuGE Navigator)
16544144 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16537246 Observational study of gene-disease association. (HuGE Navigator)
16534507 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16493615 Observational study of gene-disease association. (HuGE Navigator)
16490169 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16478753 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16476126 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16466686 Replacement of Ile106 with Glu, engineered to cause electrostatic repulsion with Glu216, had a profound topological effect in the higher region within the active site cavity and impaired the catalytic activity towards CYP2D6 probe substrates.
16459354 Observational study of gene-disease association. (HuGE Navigator)
16423440 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16415111 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16361630 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16352597 Crystal structure of human cytochrome P450 2D6
16337409 Observational study of gene-disease association. (HuGE Navigator)
16315032 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16294366 Observational study of gene-disease association. (HuGE Navigator)
16283274 Observational study of genotype prevalence. (HuGE Navigator)
16272752 researchers found a novel structure of the CYP2D6 gene, which might lead to incorrect genotyping for CYP2D6*5
16249913 Observational study of genotype prevalence. (HuGE Navigator)
16249913 The observed frequency of the CYP2D6 alleles tested was unique for the Mexican Mestizo sample analyzed
16239355 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16236141 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16220080 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16220080 CYP2D6 genotype significantly affects circadian variations of beta-adrenergic inhibition induced by metoprolol
16205777 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16198657 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16189709 Observational study of genotype prevalence. (HuGE Navigator)
16162505 analysis of active-site residues in quinidine binding to CYP2D6
16160620 Observational study of gene-disease association. (HuGE Navigator)
16141609 Observational study of genotype prevalence. (HuGE Navigator)
16130179 Observational study of genotype prevalence. (HuGE Navigator)
16130179 The frequency of the wild-type CYP2D6*1 allele was 31% in Spain
16079496 Observational study of gene-disease association. (HuGE Navigator)
16048566 Observational study of gene-disease association. (HuGE Navigator)
16037945 Hepatitis C positive/LKM1+ sera recognize a specific conformational epitope on cytochrome 2 D6 between amino acids 254 to 288, the region that contains the major linear epitope in type 2 autoimmune hepatitis patients.
16025294 Observational study of genotype prevalence. (HuGE Navigator)
16024198 Observational study of gene-disease association. (HuGE Navigator)
16006997 Observational study of gene-disease association. (HuGE Navigator)
15987423 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15970126 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15952058 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15932952 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15914211 Observational study of gene-disease association. (HuGE Navigator)
15861039 Meta-analysis of gene-disease association. (HuGE Navigator)
15861039 CYP2D6 loss of function alleles may predispose to tardive dyskinesia in patients with schizophrenia under treatment
15855722 Observational study of genotype prevalence. (HuGE Navigator)
15843230 Observational study of gene-disease association. (HuGE Navigator)
15820320 Observational study of gene-disease association. (HuGE Navigator)
15820320 CYP2D6 not associated with susceptibility to tardive dyskinesia in chronic schizophrenia subjects
15817819 Observational study of genotype prevalence. (HuGE Navigator)
15813658 Observational study of gene-disease association. (HuGE Navigator)
15774926 Observational study of gene-disease association. (HuGE Navigator)
15770075 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15770075 Definite differences in pharmacokinetics were observed between CYP2D6 genotypes in the pharmacokinetics of oral itraconazole.
15769360 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15768052 Observational study of genotype prevalence. (HuGE Navigator)
15764408 Reported CYP2D6 phenocopying is not due to dextropropoxyphene being a CYP2D6 substrate.
15731591 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15729081 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15726636 CYP2D6*31, is characterized by mutations encoding three amino acid substitutions: Arg296Cys, Arg440His and Ser486Thr, altering the kinetics.
15708542 Observational study of gene-disease association. (HuGE Navigator)
15708542 Our results demonstrate that the CYP3A5*1 allele, previously reported as a marker for CYP3A5 expression in human kidney, is associated with increased risk for BEN, while CYP3A4*1B and CYP2D6 genotypes do not significantly modify the risk for the disease.
15691505 Observational study of genetic testing. (HuGE Navigator)
15690482 Observational study of gene-disease association. (HuGE Navigator)
15669884 Observational study of gene-environment interaction. (HuGE Navigator)
15651900 Observational study of genotype prevalence. (HuGE Navigator)
15648054 Observational study of genotype prevalence. (HuGE Navigator)
15646732 Poor CYP2D6 metabolizers may be at higher risk of adverse reactions to metoprolol.
15632378 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15618665 Observational study of genetic testing. (HuGE Navigator)
15592325 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15590749 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15588859 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15584944 Observational study of gene-disease association. (HuGE Navigator)
15538128 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15499201 Five novel nonsynonymous single nucleotide polymorphisms are reported and 65 other sequence variations detected from the gene coding for cytochrome P450 (CYP) 2D6 in 254 Japanese subjects.
15484318 Three new alternative splicing variants of CYP2D6 mRNA have been identified.
15470329 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15469888 Results describe the effects of genetic polymorphism of cytochrome P450 2D6 on the metabolism of neuroactive steroids and amines in the brain.
15382273 Observational study of gene-disease association. (HuGE Navigator)
15349706 Observational study of gene-disease association. (HuGE Navigator)
15349705 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15330195 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15313161 Observational study of genetic testing. (HuGE Navigator)
15289790 Observational study of genotype prevalence. (HuGE Navigator)
15260906 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15260906 "...the present results show that CYP2D6, but not CYP2C9, may be related to QTc lengthening during treatment with risperidone." pp 191-192.
15256524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15237854 polymorphic CYP2D6 may play an important role in the interconversions of these psychoactive tryptamines, including a crucial step in a serotonin-melatonin cycle (Review)
15205367 Clinical trial of gene-environment interaction. (HuGE Navigator)
15177309 Observational study of genotype prevalence. (HuGE Navigator)
15177309 CYP2D6,...expressed at rather low levels compared to... other human CYPs, plays an important role in metabolism, partially or to a major extent for the oxidative biotransformation of a variety of psychoactive and cardiovascular drugs.
15149890 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15149890 carriers with three functional CYP2D6 genes, CYP2D6*1 x 2/*2 or CYP2D6*1/*2 x 2, are ultrarapid metabolizer phenotypes and there is no gene-dose between carriers with two and three CYP2D6*10 mutated genes
15118351 Observational study of gene-disease association. (HuGE Navigator)
15118351 The CYP2D6*10 C188T polymorphism may be associated with the susceptibility to the occurrence of TD induced by typical antipsychotics, especially in male patients, and may also be correlated with AIMS scores in TD patients.
15116051 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15115913 Observational study of gene-disease association. (HuGE Navigator)
15108188 Observational study of gene-disease association. (HuGE Navigator)
15090156 Observational study of genetic testing. (HuGE Navigator)
15068562 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15061826 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15048614 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15005635 Clinical trial of gene-environment interaction. (HuGE Navigator)
14991823 Observational study of gene-environment interaction. (HuGE Navigator)
14985156 Observational study of gene-disease association. (HuGE Navigator)
14748763 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14726986 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14726620 Cytochrome P(450)IID6's activity may play a role in the development of Type 1 diabetes mellitus.
14716707 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14658041 Observational study of gene-environment interaction. (HuGE Navigator)
14653957 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14652703 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14640293 Observational study of gene-disease association. (HuGE Navigator)
14639062 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14635107 Observational study of genetic testing. (HuGE Navigator)
14624403 Observational study of genotype prevalence, gene-environment interaction, and genetic testing. (HuGE Navigator)
14602525 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
14571354 Observational study of genotype prevalence, gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14557687 Meta-analysis of gene-disease association. (HuGE Navigator)
14520122 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14515061 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14514498 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14499440 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14499440 CYP2D6 genotype has an impact on analgesia with tramadol. Pharmacogenetics may explain some of the varying response to pain medication in postoperative patients.
14499311 Observational study of gene-environment interaction. (HuGE Navigator)
13680033 Observational study of genetic testing. (HuGE Navigator)
12963435 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12960748 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12960748 Homozygotes of CYP2D6*2 and CYP2D6*10 appear to be a susceptibility factor for developing acute extrapyramidal symptoms in schizophrenic patients.
12950145 Observational study of genotype prevalence. (HuGE Navigator)
12950145 The prevalence of CYP2D6 mutations of allelic variants predict genotype frequency in the Croatian population.
12942225 Observational study of genotype prevalence. (HuGE Navigator)
12919180 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12915955 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12911679 Observational study of genotype prevalence. (HuGE Navigator)
12900872 CYP2D6 and CYP2C19 do not significantly contribute to the metabolism of Methaqualone; although interindividual differences in the monitored metabolic patterns were noted, no marked difference could be related to a CYP2D6 or CYP2C19 polymorphism.
12900870 CYP2C9 and CYP2C19 provided enhanced formation of R-EDDP from methadone and CYP2D6 incubation resulted in the preferential conversion to S-EDDP.
12893130 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12883230 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12879776 Observational study of gene-disease association. (HuGE Navigator)
12879776 CYP2D6 gene is a marker for genetic susceptibility to allergic perennial rhinitis
12879168 Observational study of genotype prevalence. (HuGE Navigator)
12861292 Observational study of gene-disease association. (HuGE Navigator)
12784098 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12782969 Observational study of gene-disease association. (HuGE Navigator)
12782969 These results do not support the hypothesis that CYP2D6 activity affects temperament and character.
12766554 Observational study of gene-environment interaction. (HuGE Navigator)
12748560 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12743673 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12734765 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12728976 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12691769 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12657030 Observational study of gene-disease association. (HuGE Navigator)
12651805 Observational study of genetic testing. (HuGE Navigator)
12629505 Observational study of gene-disease association. (HuGE Navigator)
12629505 Male schizophrenics with at least one decreased or loss of function allele for CYP2D6 have a moderately greater chance of developing tardive dyskinesia than males with only wild-type alleles.
12622923 Observational study of genotype prevalence. (HuGE Navigator)
12616663 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12610741 Observational study of gene-environment interaction. (HuGE Navigator)
12589966 Observational study of genetic testing. (HuGE Navigator)
12579870 Observational study of genetic testing. (HuGE Navigator)
12569554 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12548461 Observational study of gene-disease association. (HuGE Navigator)
12536989 Observational study of genotype prevalence. (HuGE Navigator)
12503836 patients with impaired CYP2D6 enzyme activity due to enzyme inhibition by thioridazine might be more prone to increased risk of sudden death due to torsade de pointes type cardiac dysrhythmia
12490310 Observational study of gene-disease association. (HuGE Navigator)
12486288 Observational study of gene-disease association. (HuGE Navigator)
12486288 We have examined frequency of the CYP2D6*4 allele of debrisoquine hydroxylase (DBH) involving G/A transition at the intron 3-exon 4 junction in dementia with Lewy bodies[DLB]; this allele does not act as a risk factor for DLB
12468438 Observational study of gene-disease association. (HuGE Navigator)
12459840 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12446689 role of glutatmate 216 and aspartate 301 in determining substrate specificity and product regioselectivity
12439227 new allelic arrangement in a poor metabolizer in debrisoquine
12438554 The functional differences between CYP2D6.1, CYP2D6.2, CYP2D6.10, and CYP2D6.17 allelic isoforms toward three clinically important substrates have been compared, and alterations in their metabolic capacities have been demonstrated.
12426523 Observational study of gene-environment interaction. (HuGE Navigator)
12422998 Observational study of gene-disease association. (HuGE Navigator)
12421483 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12419832 Observational study of gene-disease association. (HuGE Navigator)
12404686 Observational study of gene-disease association. (HuGE Navigator)
12392820 an alteration in position of active-site residues in CYP2D6.17 as a possible explanation for the reduced activity of the enzyme.
12386646 Observational study of gene-environment interaction. (HuGE Navigator)
12386645 Observational study of gene-disease association. (HuGE Navigator)
12360109 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12360109 contributes to the biotransformation of E- and X-doxepin in healthy volunteers
12210290 This study suggests that these polymorphisms are not related to the development of tardive dystonia.
12207635 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12206675 Study of oxidation of non-amine ligands and substrates by cytochrome P450 2D6 reveals lack of an obligatory role for Asp-301 in substrate electrostatic bonding.
12191703 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12187002 Observational study of gene-disease association. (HuGE Navigator)
12175908 Observational study of genotype prevalence. (HuGE Navigator)
12175908 Duplicated alleles of CYP2D6*10 exist in the Japanese population and that it may be one of the factors affecting the capacity of Japanese to metabolize various CYP2D6 substrate drugs.
12172336 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12172215 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12172215 the pronounced effect of the CYP2D6 genotype persists during long-term therapy, affecting both metabolic ratio and metoprolol plasma concentration.
12171760 Patients who had homozygous (L/L) or heterozygous (Wt/L) mutant alleles developed manganism an average of 10 years later than those who were homozygous wildtype
12152006 Observational study of gene-disease association. (HuGE Navigator)
12152006 lower activity observed in a black American population is in part attributable to the presence of variant alleles that occur at a higher frequency in this population than in white subjects
12142727 Observational study of gene-disease association. (HuGE Navigator)
12142727 results indicate a significant influence of environmental factors as an explanation for the difference in capacity for CYP2D6, but not CYP2C19 metabolism between Caucasians and Black Africans
12107620 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12106691 demonstrate constitutive expression of cytochrome P4502D in neuronal cell population in human brain, indicating its possible role in metabolism of psychoactive drugs directly at or near their site of action, in neurons, in human brain.
12089164 Observational study of genotype prevalence. (HuGE Navigator)
12077255 The antigenic constitution of CYP2D6, the major target of liver kidney microsomal antibody type 1 in type 2 autoimmune hepatitis and chronic hepatitis C virus infections, has been initially characterized.
12065557 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12063626 Observational study of gene-disease association. (HuGE Navigator)
11940091 treatment-resistant schizophrenia -duplication in the cytochrome P450IID6 (CYP2D6) gene
11927839 Observational study of gene-disease association. (HuGE Navigator)
11927839 CYP2D6 genotype is associated with antipsychotic-induced extrapyramidal syndromes
11901361 polymorphisms and atypical antipsychotic weight gain
11895912 Observational study of gene-disease association. (HuGE Navigator)
11829201 Observational study of genotype prevalence. (HuGE Navigator)
11816009 determination of phenotype in liver microsomes
11809184 Observational study of gene-environment interaction. (HuGE Navigator)
11791895 CYP2D6 catalyzes the major metabolic pathway of fluvoxamine.
11778144 Observational study of gene-disease association. (HuGE Navigator)
11763000 Observational study of gene-disease association. (HuGE Navigator)
11753272 Observational study of genotype prevalence. (HuGE Navigator)
11753271 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11751440 Observational study of genotype prevalence. (HuGE Navigator)
11750286 Anti-CYP2D6 antibodies detected by quantitative radioligand assay and relation to antibodies to liver-specific arginase in patients with autoimmune hepatitis.
11741249 Clinical trial of genetic testing. (HuGE Navigator)
11735606 Observational study of gene-environment interaction. (HuGE Navigator)
11702057 Observational study of gene-disease association. (HuGE Navigator)
11682257 Observational study of genetic testing. (HuGE Navigator)
11668217 Observational study of gene-disease association. (HuGE Navigator)
11560558 Observational study of gene-environment interaction. (HuGE Navigator)
11549206 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11520401 Observational study of gene-disease association. (HuGE Navigator)
11505219 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11477317 Clinical trial of gene-environment interaction. (HuGE Navigator)
11470994 Observational study of genotype prevalence. (HuGE Navigator)
11442888 Observational study of gene-disease association. (HuGE Navigator)
11422615 Observational study of gene-disease association. (HuGE Navigator)
11422605 Observational study of genotype prevalence. (HuGE Navigator)
11376189 Observational study of gene-disease association. (HuGE Navigator)
11372584 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11303596 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11295783 Observational study of gene-disease association. (HuGE Navigator)
11294012 Observational study of genotype prevalence. (HuGE Navigator)
11291049 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11285084 Observational study of gene-disease association. (HuGE Navigator)
11266079 Observational study of gene-disease association. (HuGE Navigator)
11214775 Observational study of gene-environment interaction. (HuGE Navigator)
11207032 Observational study of genotype prevalence. (HuGE Navigator)
11207030 Observational study of gene-disease association. (HuGE Navigator)
11204351 Observational study of gene-disease association. (HuGE Navigator)
11147929 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11097352 Observational study of gene-disease association. (HuGE Navigator)
11097351 Observational study of gene-disease association. (HuGE Navigator)
11055624 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11037802 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11037800 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MGLEALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFS      1 - 70
LQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLR     71 - 140
NLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQ    141 - 210
EGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEME    211 - 280
KAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQ    281 - 350
AHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHF    351 - 420
LDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPY    421 - 490
ELCAVPR                                                                   491 - 497
//

Text Mined References (891)

PMID Year Title
26902503 2016 Alternative methods for CYP2D6 phenotyping: comparison of dextromethorphan metabolic ratios from AUC, single point plasma, and urine.
26839488 2016 Genetic Polymorphism of CYP2D6 and Clomiphene Concentrations in Infertile Patients with Ovulatory Dysfunction Treated with Clomiphene Citrate.
26768225 2016 The roles of apolipoprotein E3 and CYP2D6 (rs1065852) gene polymorphisms in the predictability of responses to individualized therapy with donepezil in Han Chinese patients with Alzheimer's disease.
26652007 2016 Functional characterization of CYP2D6 novel allelic variants identified in the Chinese Han population.
26603528 2015 Stereoselective metabolism of donepezil and steady-state plasma concentrations of S-donepezil based on CYP2D6 polymorphisms in the therapeutic responses of Han Chinese patients with Alzheimer's disease.
26551314 2016 CYP2D6 copy number distribution in the US population.
26514968 2016 Genotype and co-medication dependent CYP2D6 metabolic activity: effects on serum concentrations of aripiprazole, haloperidol, risperidone, paliperidone and zuclopenthixol.
26510986 CYP2D6 Genetic Polymorphisms and Phenotypes in Different Ethnicities of Malaysian Breast Cancer Patients.
26434912 2015 CYP2D6 Genotype and Risk of Recurrence in Tamoxifen Treated Breast Cancer Patients.
26406933 2016 Effect of CYP2D6 variants on venlafaxine metabolism in vitro.
26369533 2015 CYP2D6 genotype- and endoxifen-guided tamoxifen dose escalation increases endoxifen serum concentrations without increasing side effects.
26316040 2016 Association of Polymorphisms of Cytochrome P450 2D6 With Blood Hydroxychloroquine Levels in Patients With Systemic Lupus Erythematosus.
26310775 2016 Effects of 22 Novel CYP2D6 Variants Found in the Chinese Population on the Bufuralol and Dextromethorphan Metabolisms In Vitro.
26298540 2015 Cytochrome P450 genotypes are not associated with refractoriness to antipsychotic treatment.
26297049 2016 Coding-noncoding gene expression in intrahepatic cholangiocarcinoma.
26287939 2015 Effect of genotype and methylation of CYP2D6 on smoking behaviour.
26252353 2015 RRM1, TUBB3, TOP2A, CYP19A1, CYP2D6: Difference between mRNA and protein expression in predicting prognosis of breast cancer patients.
26235034 2015 The impact of the CYP2D6 gene polymorphism on the risk of pemphigoid.
26230381 2015 Aberrant CYP2D6 metabolizer phenotypes do not show increased frequency in patients undergoing ECT after antidepressant therapy.
26211952 2015 Characterization of the CYP2D6 drug metabolizing phenotypes of the Chilean mestizo population through polymorphism analyses.
26084127 2015 CYP 2D6*4 polymorphism and interindividual response variation to metoprolol in stage 1 hypertensive patients: no association in a rural Indian population?
25999696 2015 Prevalence of the CYP2D6*10 (C100T), *4 (G1846A), and *14 (G1758A) alleles among Iranians of different ethnicities.
25989235 2015 Role of CYP2D6 Polymorphisms in the Outcome of Postoperative Pain Treatment.
25967538 2015 Cytochrome P450 2D6 genotype affects the pharmacokinetics of controlled-release paroxetine in healthy Chinese subjects: comparison of traditional phenotype and activity score systems.
25963137 2015 CYP2D6*4 polymorphism: A new marker of response to hormonotherapy in male breast cancer?
25943116 2015 Estrogen-Induced Cholestasis Leads to Repressed CYP2D6 Expression in CYP2D6-Humanized Mice.
25941923 2015 Interethnic relationships of CYP2D6 variants in native and Mestizo populations sharing the same ecosystem.
25933954 2015 Increased prevalence of functional minor allele variants of drug metabolizing CYP2B6 and CYP2D6 genes in Roma population samples.
25868121 2015 The Influence of the CYP3A4*22 Polymorphism and CYP2D6 Polymorphisms on Serum Concentrations of Aripiprazole, Haloperidol, Pimozide, and Risperidone in Psychiatric Patients.
25857198 2015 [CYP2D6, CYP3A5, and CYP3A4 gene polymorphism in Russian, Tatar, and Bashkir populations].
25825958 2015 Impact of CYP2D6 Polymorphisms on Postoperative Fentanyl Analgesia in Gastric Cancer Patients.
25823457 2015 Associations between ADRB1 and CYP2D6 gene polymorphisms and the response to ?-blocker therapy in hypertension.
25803758 2016 Pharmacogenetic Testing for Analgesic Adverse Effects: Pediatric Case Series.
25788121 2015 SNP genotyping using TaqMan technology: the CYP2D6*17 assay conundrum.
25743120 2015 Genetic polymorphisms of CYP2D6*10 and the effectiveness of combined tamoxifen citrate and testosterone undecanoate treatment in infertile men with idiopathic oligozoospermia.
25720195 2014 Ethnic background and CYP2D6 genetic polymorphisms in Costa Ricans.
25701109 2015 Association of CYP2D6*10, OATP1B1 A388G, and OATP1B1 T521C polymorphisms and overall survival of breast cancer patients after tamoxifen therapy.
25609939 2015 Characterization of hepatic enzyme activity in older adults with dementia: potential impact on personalizing pharmacotherapy.
25555909 2015 Contributions of ionic interactions and protein dynamics to cytochrome P450 2D6 (CYP2D6) substrate and inhibitor binding.
25552922 2015 Combination analysis in genetic polymorphisms of drug-metabolizing enzymes CYP1A2, CYP2C9, CYP2C19, CYP2D6 and CYP3A5 in the Japanese population.
25521354 2014 Detection of an endogenous urinary biomarker associated with CYP2D6 activity using global metabolomics.
25510856 2015 The influences of CYP2D6 genotypes and drug interactions on the pharmacokinetics of venlafaxine: exploring predictive biomarkers for treatment outcomes.
25495408 2014 CYP2D6 genetic polymorphisms in Southern Mexican Mayan Lacandones and Mestizos from Chiapas.
25495406 2014 Polymorphic expression of CYP2C19 and CYP2D6 in the developing and adult human brain causing variability in cognition, risk for depression and suicide: the search for the endogenous substrates.
25469868 2015 In vitro functional assessment of 22 newly identified CYP2D6 allelic variants in the Chinese population.
25437930 2014 CYP2D6 polymorphism and mental and personality disorders in suicide attempters.
25381333 2015 Functional characterization of CYP2D6 enhancer polymorphisms.
25378122 2014 Evaluation of endometrial thickness and bone mineral density based on CYP2D6 polymorphisms in Turkish breast cancer patients receiving tamoxifen treatment.
25329392 2014 Distribution of CYP2D6 alleles and phenotypes in the Brazilian population.
25329115 2014 Molecular study of weight gain related to atypical antipsychotics: clinical implications of the CYP2D6 genotype.
25296365 2014 Determination of CYP2D6 *3, *4, and *10 frequency in women with breast cancer in São Luís, Brazil, and its association with prognostic factors and disease-free survival.
25261563 2014 Paroxetine markedly increases plasma concentrations of ophthalmic timolol; CYP2D6 inhibitors may increase the risk of cardiovascular adverse effects of 0.5% timolol eye drops.
25245581 2015 Influence of CYP2D6 and CYP2C19 genotypes on venlafaxine metabolic ratios and stereoselective metabolism in forensic autopsy cases.
25240994 2014 Subgrouping of patients with oral lichen planus according to cytochrome P450 enzyme phenotype and genotype.
25217496 2014 Krüppel-like factor 9 promotes hepatic cytochrome P450 2D6 expression during pregnancy in CYP2D6-humanized mice.
25141893 2014 Resolution of a clinical AmpliChip CYP450 Test™ no call: discovery and characterization of novel CYP2D6*1 haplotypes.
25138301 2014 Meta-analyses of the effect of CYP1A1 and CYP2D6 polymorphisms on the risk of head and neck squamous cell carcinoma.
25113522 2015 A combined high CYP2D6-CYP2C19 metabolic capacity is associated with the severity of suicide attempt as measured by objective circumstances.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24987171 Evaluation of cytochrome P450 2D6 phenotyping in healthy adult Western Indians.
24948072 2014 Significance of the genetic polymorphism of CYP2D6 and NAT2 in patients with inflammatory bowel diseases.
24909950 2014 Quantitative assessment of CYP2D6 polymorphisms and risk of Alzheimer's disease: a meta-analysis.
24905532 2014 The relationship between plasma concentration of metoprolol and CYP2D6 genotype in patients with ischemic heart disease.
24865344 2015 Cytochrome P450-2D6*4 polymorphism seminal relationship in infertile men.
24858822 2014 Impact of age on serum concentrations of venlafaxine and escitalopram in different CYP2D6 and CYP2C19 genotype subgroups.
24798722 2014 How common are drug and gene interactions? Prevalence in a sample of 1143 patients with CYP2C9, CYP2C19 and CYP2D6 genotyping.
24682161 2014 Effects of genetic polymorphisms of CYP2D6, CYP3A5, and ABCB1 on the steady-state plasma concentrations of aripiprazole and its active metabolite, dehydroaripiprazole, in Japanese patients with schizophrenia.
24663076 2014 Effect of CYP2D6, CYP2C9 and ABCB1 genotypes on fluoxetine plasma concentrations and clinical improvement in children and adolescent patients.
24660534 2014 An observational study of Venlafaxine and CYP2D6 in clinical practice.
24640604 2014 Effect of the cytochrome P450 2D6*10 genotype on the pharmacokinetics of tramadol in post-operative patients.
24557547 2014 Effect of exposure to acute and chronic high-altitude hypoxia on the activity and expression of CYP1A2, CYP2D6, CYP2C9, CYP2C19 and NAT2 in rats.
24533713 2014 CYP2D6 gene polymorphisms and predicted phenotypes in eight indigenous groups from northwestern Mexico.
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
24510399 2015 Effect of Curcuma longa on CYP2D6- and CYP3A4-mediated metabolism of dextromethorphan in human liver microsomes and healthy human subjects.
24495562 2014 The CYP2D6 gene determines oxycodone's phenotype-specific addictive potential: implications for addiction prevention and treatment.
24488700 2014 Neither cytochrome P450 family genes nor neuroendocrine factors could independently predict the SSRIs treatment in the Chinese Han population.
24449363 2014 Association of CYP1A1 and CYP2D6 gene polymorphisms with head and neck cancer in Tunisian patients.
24376807 2013 CYP2D6*4 allele polymorphism increases the risk of Parkinson's disease: evidence from meta-analysis.
24340040 2013 Polymorphic cytochrome P450 enzymes (CYPs) and their role in personalized therapy.
24338437 2014 The effect of genetic polymorphisms of cytochrome P450 CYP2C9, CYP2C19, and CYP2D6 on drug-resistant epilepsy in Turkish children.
24329190 2014 Association between CYP2D6 genotypes and the clinical outcomes of adjuvant tamoxifen for breast cancer: a meta-analysis.
24329187 2014 Effect of CYP2D6 on risperidone pharmacokinetics and extrapyramidal symptoms in healthy volunteers: results from a pharmacogenetic clinical trial.
24318876 2014 Altered expression of small heterodimer partner governs cytochrome P450 (CYP) 2D6 induction during pregnancy in CYP2D6-humanized mice.
24279852 2013 CYP2D6 -1584C>G promoter polymorphism and debrisoquine ultrarapid hydroxylation in healthy volunteers.
24265353 2014 The rs1800716 variant in CYP2D6 is associated with an increased double endometrial thickness in postmenopausal women on tamoxifen.
24265036 2014 CYP2D6 genotype in relation to hot flashes as tamoxifen side effect in a Dutch cohort of the tamoxifen exemestane adjuvant multinational (TEAM) trial.
24257813 2014 Genetic differences in cytochrome P450 enzymes and antidepressant treatment response.
24232670 2013 New aQTL SNPs for the CYP2D6 identified by a novel mediation analysis of genome-wide SNP arrays, gene expression arrays, and CYP2D6 activity.
24211060 2014 CYP2D6 phenotypes and Parkinson's disease risk: a meta-analysis.
24192122 2013 Genetic variations of human CYP2D6 in the Chinese Han population.
24161632 2013 Understanding CYP2D6 and its role in tamoxifen metabolism.
24156754 2014 Statin therapy correlated CYP2D6 gene polymorphism and hyperlipidemia.
24151801 2013 Towards the implementation of CYP2D6 and CYP2C19 genotypes in clinical practice: update and report from a pharmacogenetic service clinic.
24151800 2013 Complexities of CYP2D6 gene analysis and interpretation.
24125101 2014 No association found between CYP2D6 genotype and early breast cancer events in tamoxifen-treated patients.
24121619 2013 High prevalence of CYP2D6*41 (G2988A) allele in Saudi Arabians.
24112176 2013 No association between cytochrome P450 2D6 gene polymorphism and risk of acute leukemia: evidence based on a meta-analysis.
24107805 2014 Impact of CYP2D6 and CYP3A4 genetic polymorphism on combined cholinesterase inhibitors and memantine treatment in mild to moderate Alzheimer's disease.
24098545 2013 CYP2D6 genotype and tamoxifen response for breast cancer: a systematic review and meta-analysis.
24089073 2014 Association between inherited CYP2D6/2C19 phenotypes and anticholinergic measures in elderly patients using anticholinergic drugs.
24088226 2013 Association of CYP2D6 metabolizer status with mammographic density change in response to tamoxifen treatment.
24088129 2013 Comparative study of polymorphism frequencies of the CYP2D6, CYP3A5, CYP2C8 and IL-10 genes in Mexican and Spanish women with breast cancer.
24088126 2013 Relationship between CYP2D6 genotype and haloperidol pharmacokinetics and extrapyramidal symptoms in healthy volunteers.
24033670 2014 CYP2D6 variation, behaviour and psychopathology: implications for pharmacogenomics-guided clinical trials.
23985325 2014 Common CYP2D6 polymorphisms affecting alternative splicing and transcription: long-range haplotypes with two regulatory variants modulate CYP2D6 activity.
23981149 2013 Estimation of CYP2D6*10 genotypes on citalopram disposition in Chinese subjects by population pharmacokinetic assay.
23922954 2013 Relationship between genotypes Sult1a2 and Cyp2d6 and tamoxifen metabolism in breast cancer patients.
23897164 2013 Functional influence of human CYP2D6 allelic variations: P34S, E418K, S486T, and R296C.
23893861 2013 Pharmacogenetic testing in the face of unclear clinical efficacy: lessons from cytochrome P450 2D6 for tamoxifen.
23876819 2013 Evaluation of in vitro cytochrome P450 induction and inhibition activity of deoxyelephantopin, a sesquiterpene lactone from Elephantopus scaber L.
23872830 2013 CYP2D6 genotype should not be used to determine endocrine therapy in postmenopausal breast cancer patients.
23870808 2013 CYP450 pharmacogenetic treatment strategies for antipsychotics: a review of the evidence.
23855716 2013 Polymorphisms in CYP2D6 may predict methamphetamine related heart failure.
23851570 2013 The effect of the Taq1A variant in the dopamine D? receptor gene and common CYP2D6 alleles on prolactin levels in risperidone-treated boys.
23842856 2013 CYP2D6 genotype in relation to tamoxifen efficacy in a Dutch cohort of the tamoxifen exemestane adjuvant multinational (TEAM) trial.
23831869 2013 The association between CYP2D6 genotype and switching antipsychotic medication to clozapine.
23809878 2013 Mechanism of autoimmune hepatic fibrogenesis induced by an adenovirus encoding the human liver autoantigen cytochrome P450 2D6.
23803265 2013 Pharmacogenomics: why standard codeine doses can have serious toxicities or no therapeutic effect.
23781139 2013 Influence of CYP2D6 polymorphisms on serum levels of tamoxifen metabolites in Spanish women with breast cancer.
23737191 2013 Patients with difficult-to-treat depression do not exhibit an increased frequency of CYP2D6 allele duplication.
23734807 2013 Length of psychiatric hospitalization is correlated with CYP2D6 functional status in inpatients with major depressive disorder.
23733622 2013 Cancer cachexia raises the plasma concentration of oxymorphone through the reduction of CYP3A but not CYP2D6 in oxycodone-treated patients.
23728524 2014 The effect of mirabegron, a potent and selective ?3-adrenoceptor agonist, on the pharmacokinetics of CYP2D6 substrates desipramine and metoprolol.
23712329 2013 CYP2D6 polymorphisms influence tamoxifen treatment outcomes in breast cancer patients: a meta-analysis.
23700791 2013 Effects of CYP3A5 and CYP2D6 genetic polymorphism on the pharmacokinetics of diltiazem and its metabolites in Chinese subjects.
23691026 2013 Modelling species selectivity in rat and human cytochrome P450 2D enzymes.
23686417 2013 Influence of CYP2D6-genotype on tamoxifen efficacy in advanced breast cancer.
23664723 2013 Polymorphisms of CYP2D6 gene and gefitinib-induced hepatotoxicity.
23644254 2013 Polymorphisms and phenotypic analysis of cytochrome P450 2D6 in the Tibetan population.
23614566 2013 Potential role of CYP2D6 in the central nervous system.
23609392 2013 Pharmacogenetic study on risperidone long-acting injection: influence of cytochrome P450 2D6 and pregnane X receptor on risperidone exposure and drug-induced side-effects.
23570465 2013 CYP2D6 and adjuvant tamoxifen: possible differences of outcome in pre- and post-menopausal patients.
23558964 2013 CYP2D6 T188C variant is associated with lung cancer risk in the Chinese population.
23555934 2013 CYP2D6 genotype dependent oxycodone metabolism in postoperative patients.
23552177 2013 Double site saturation mutagenesis of the human cytochrome P450 2D6 results in regioselective steroid hydroxylation.
23545896 2014 Influence of CYP2D6 and CYP2C19 gene variants on antidepressant response in obsessive-compulsive disorder.
23503455 2013 Relationship of CYP2D6, CYP3A, POR, and ABCB1 genotypes with galantamine plasma concentrations.
23471717 2013 CYP2A6, CYP1A1, and CYP2D6 polymorphisms in lung cancer patients from central south China.
23469064 2013 Systematic functional study of cytochrome P450 2D6 promoter polymorphisms in the Chinese Han population.
23394389 2013 Characterization of the CYP2D6 gene locus and metabolic activity in Indo- and Afro-Trinidadians: discovery of novel allelic variants.
23357843 2013 Pharmacokinetic model incorporating mechanism-based inactivation of CYP2D6 can explain both non-linear kinetics and drug interactions of paroxetine.
23350374 2012 [Genetic polymorphisms and breast cancer].
23292115 2013 Effect of HNF4? genetic polymorphism G60D on the pharmacokinetics of CYP2D6 substrate tolterodine in healthy Korean individuals.
23289191 2012 Side effects associated with ultrarapid cytochrome P450 2D6 genotype among women with early stage breast cancer treated with tamoxifen.
23280482 2013 Analysis of CYP2D6 genotype and response to tetrabenazine.
23277250 2013 A thorough QTc study of 3 doses of iloperidone including metabolic inhibition via CYP2D6 and/or CYP3A4 and a comparison to quetiapine and ziprasidone.
23258538 2013 Metabolism of 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine by mitochondrion-targeted cytochrome P450 2D6: implications in Parkinson disease.
23213055 2013 CYP2D6 metabolism and patient outcome in the Austrian Breast and Colorectal Cancer Study Group trial (ABCSG) 8.
23212934 2012 Avoiding serotonin syndrome: the nature of the interaction between tramadol and selective serotonin reuptake inhibitors.
23207012 2012 Reduced CYP2D6 function is associated with gefitinib-induced rash in patients with non-small cell lung cancer.
23167378 2012 Impact of CYP2D6 polymorphisms on tamoxifen responses of women with breast cancer: a microarray-based study in Thailand.
22994728 2012 Genetic variants of CYP2D6 gene and cancer risk: a HuGE systematic review and meta-analysis.
22986607 2013 Effect of CYP2D6*10 and APOE polymorphisms on the efficacy of donepezil in patients with Alzheimer's disease.
22948856 2013 Pharmacokinetic and tolerability profile of pridopidine in healthy-volunteer poor and extensive CYP2D6 metabolizers, following single and multiple dosing.
22929407 2012 Population pharmacokinetic modeling of risperidone and 9-hydroxyrisperidone to estimate CYP2D6 subpopulations in children and adolescents.
22913530 2012 Distribution of CYP2D6 and CYP2C19 polymorphisms associated with poor metabolizer phenotype in five Amerindian groups and western Mestizos from Mexico.
22905959 2012 Frequency of certain single-nucleotide polymorphisms and duplication of CYP2D6 in the Jordanian population.
22803153 2012 Cytochrome P450 2D6 polymorphism is a molecular genetic marker of liver cirrhosis progression.
22777153 2012 Endoxifen levels and its association with CYP2D6 genotype and phenotype: evaluation of a southern Brazilian population under tamoxifen pharmacotherapy.
22775532 2012 The AmpliChip® CYP450 test and response to treatment in schizophrenia and obsessive compulsive disorder: a pilot study and focus on cases with abnormal CYP2D6 drug metabolism.
22735900 2012 Relationships between CYP2D6 phenotype, breast cancer and hot flushes in women at high risk of breast cancer receiving prophylactic tamoxifen: results from the IBIS-I trial.
22733239 2013 Use of pharmacogenetics in bioequivalence studies to reduce sample size: an example with mirtazapine and CYP2D6.
22718526 2013 The association of CYP2D6 genotype and postoperative nausea and vomiting in orthopedic trauma patients.
22700965 2012 Nicotine and 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone binding and access channel in human cytochrome P450 2A6 and 2A13 enzymes.
22688624 2012 Impact of CYP2D6 polymorphism on tamoxifen therapy: where are we?
22661184 2012 Significance of genetic polymorphism of CYP2D6 in the pathogenesis of systemic sclerosis.
22623266 2012 Population pharmacokinetic analysis of risperidone and 9-hydroxyrisperidone with genetic polymorphisms of CYP2D6 and ABCB1.
22623212 2012 Genetic polymorphisms of CYP2D6 increase the risk for recurrence of breast cancer in patients receiving tamoxifen as an adjuvant therapy.
22531512 CYP 2D6 polymorphism: a predictor of susceptibility and response to chemoradiotherapy in head and neck cancer.
22497725 2012 CYP2D6 poor metabolizer genotype and smoking predict severe postoperative pain in female patients on arrival to the recovery room.
22459173 2012 Binding of quinidine radically increases the stability and decreases the flexibility of the cytochrome P450 2D6 active site.
22428763 2012 Tramadol efficacy in patients with postoperative pain in relation to CYP2D6 and MDR1 polymorphisms.
22399238 2012 The dopaminergic stabilizer pridopidine is to a major extent N-depropylated by CYP2D6 in humans.
22398969 2012 Prediction of codeine toxicity in infants and their mothers using a novel combination of maternal genetic markers.
22355045 2012 Time-dependent interaction between differentiated embryo chondrocyte-2 and CCAAT/enhancer-binding protein ? underlies the circadian expression of CYP2D6 in serum-shocked HepG2 cells.
22324840 2012 CYP2D6 gene variants in urban/admixed and Amerindian populations of Venezuela: pharmacogenetics and anthropological implications.
22308038 2012 Crystal structure of human cytochrome P450 2D6 with prinomastat bound.
22303032 2012 Ecstasy (MDMA)-induced hyponatraemia is associated with genetic variants in CYP2D6 and COMT.
22301406 2012 CYP2D6*4 allele and breast cancer risk: is there any association?
22281720 2012 Impact of CYP2D6 polymorphisms on the pharmacokinetics of lovastatin in Chinese subjects.
22281432 2013 Risk of renal cell carcinoma and polymorphism in phase I xenobiotic metabolizing CYP1A1 and CYP2D6 enzymes.
22277677 2012 Inter-individual variability of in vivo CYP2D6 activity in different genotypes.
22245658 2012 Tamsulosin exposure is significantly increased by the CYP2D6*10/*10 genotype.
22216145 2011 Identification of new alleles and the determination of alleles and genotypes frequencies at the CYP2D6 gene in Emiratis.
22198443 2012 Does the medication pattern reflect the CYP2D6 genotype in patients with diagnoses within the schizophrenic spectrum?
22180372 2011 Novel variant of CYP2D6*6 is undetected by a commonly used genotyping procedure.
22180068 2011 Distribution of HLA-B27 and CYP2D6*4 mutations in the middle Black Sea area (Tokat) of Turkey.
22159753 2012 Unimolecular and bimolecular binding system for the prediction of CYP2D6-mediated metabolism.
22141351 2012 CYP2D6 and the severity of suicide attempts.
22109568 2012 Polymorphisms in GSTM1, CYP1A1, CYP2E1, and CYP2D6 are associated with susceptibility and chemotherapy response in non-small-cell lung cancer patients.
22092298 2012 Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo: a study using codeine in methadone- and buprenorphine-maintained subjects.
22039821 2012 Pharmacophore, QSAR, and binding mode studies of substrates of human cytochrome P450 2D6 (CYP2D6) using molecular docking and virtual mutations and an application to chinese herbal medicine screening.
21989258 2012 Modeling human cytochrome P450 2D6 metabolism and drug-drug interaction by a novel panel of knockout and humanized mouse lines.
21971440 2012 Cytochrome P450 polymorphism and postoperative cognitive dysfunction.
21958961 2012 The neuroprotective enzyme CYP2D6 increases in the brain with age and is lower in Parkinson's disease patients.
21956465 2011 Association of polymorphic G1934A variant (allele *4) of CYP2D6 gene with increased risk of breast cancer development in Ukrainian women.
21918425 2011 Genetic variation, ?-blockers, and perioperative myocardial infarction.
21913948 2012 Differences in genotype and allele frequency distributions of polymorphic drug metabolizing enzymes CYP2C19 and CYP2D6 in mainland Chinese Mongolian, Hui and Han populations.
21907728 2011 Role of genetic polymorphisms of CYP1A1, CYP3A5, CYP2C9, CYP2D6, and PON1 in the modulation of DNA damage in workers occupationally exposed to organophosphate pesticides.
21880792 2011 Evaluation of CYP2D6 and efficacy of tamoxifen and raloxifene in women treated for breast cancer chemoprevention: results from the NSABP P1 and P2 clinical trials.
21861665 2011 Novel drug metabolism indices for pharmacogenetic functional status based on combinatory genotyping of CYP2C9, CYP2C19 and CYP2D6 genes.
21860550 2011 Association between genetic polymorphisms of CYP2D6 and outcomes in breast cancer patients with tamoxifen treatment.
21840870 2011 Association of ABCB1, 5-HT3B receptor and CYP2D6 genetic polymorphisms with ondansetron and metoclopramide antiemetic response in Indonesian cancer patients treated with highly emetogenic chemotherapy.
21835244 2012 Genetic variation in CYP2D6 impacts neural activation during cognitive tasks in humans.
21826689 2011 Pilot study for the characterization of pharmacogenetically relevant CYP2D6, CYP2C19 and ABCB1 gene polymorphisms in the Hungarian population.
21823108 2012 Effect of CYP2D6 polymorphisms on breast cancer recurrence.
21821735 2011 Cannabidiol, a major phytocannabinoid, as a potent atypical inhibitor for CYP2D6.
21803659 2011 Cytochrome P450 2D6 phenotyping in an elderly population with dementia and response to galantamine in dementia: a pilot study.
21797939 2011 The recipient CYP2D6 allele 4-associated poor metabolizer status correlates with an early fibrosis development after liver transplantation.
21787170 2011 CYP2D plays a major role in berberine metabolism in liver of mice and humans.
21749835 A case study: neuroleptic malignant syndrome with risperidone and CYP2D6 gene variation.
21743374 2011 CYP2D6 polymorphisms and codeine analgesia in postpartum pain management: a pilot study.
21728792 2011 CYP2D6 genotyping in natives and immigrants from the Emilia-Romagna Region (Italy).
21677335 Novel cytochrome P450-2D6 promoter sequence variations in hepatitis C positive and negative subjects.
21631295 2011 Frequencies of three CYP2D6 nonfunctional alleles (CYP2D6*3, *4, and *6) within an Iranian population (Mazandaran).
21605066 2011 Comparison of metabolic soft spot predictions of CYP3A4, CYP2C9 and CYP2D6 substrates using MetaSite and StarDrop.
21599570 2011 Carvedilol pharmacokinetics and pharmacodynamics in relation to CYP2D6 and ADRB pharmacogenetics.
21596874 2011 CYP2D6- and CYP3A-dependent enantioselective plasma concentrations of ondansetron in postanesthesia care.
21589866 2011 Contribution of cytochrome P450 and ABCB1 genetic variability on methadone pharmacokinetics, dose requirements, and response.
21576599 2011 Cholesterol 25-hydroxylation activity of CYP3A.
21543662 2012 Pharmacokinetics, safety, and tolerability of atomoxetine and effect of CYP2D6*10/*10 genotype in healthy Japanese men.
21527579 2011 CYP2D6 gene variants and their association with breast cancer susceptibility.
21518482 2011 [Relationships between the gene polymorphisms of drug metabolizing enzymes and the outcome of the first induction chemotherapy in patients with de novo acute myeloid leukemia].
21486104 2011 The World Federation of Societies of Biological Psychiatry (WFSBP) guidelines for the biological treatment of substance use and related disorders. Part 2: Opioid dependence.
21485696 Cytochrome P450 polymorphism--molecular, metabolic, and pharmacogenetic aspects. IV. Application of long polymerase chain reaction for identification of CYP2D6 gene duplication.
21456632 2011 Sex differences in 3,4-methylenedioxymethamphetamine (MDMA; ecstasy)-induced cytochrome P450 2D6 inhibition in humans.
21449914 2011 Influence of ABCB1 genetic polymorphisms on the pharmacokinetics of risperidone in healthy subjects with CYP2D6*10/*10.
21437611 2012 Lack of any association between functionally significant CYP2D6 polymorphisms and clinical outcomes in early breast cancer patients receiving adjuvant tamoxifen treatment.
21433154 2011 Inhibition of human cytochrome P450 enzymes 3A4 and 2D6 by ?-carboline alkaloids, harmine derivatives.
21430657 2011 Tamoxifen metabolite concentrations, CYP2D6 genotype, and breast cancer outcomes.
21391885 2011 Resequencing, haplotype construction and identification of novel variants of CYP2D6 in Mexican Mestizos.
21321564 2011 High risk of lifetime history of suicide attempts among CYP2D6 ultrarapid metabolizers with eating disorders.
21248727 2011 CYP2D6 in the brain: impact on suicidality.
21241245 2011 Genetic transmission of cytochrome P450 2D6 (CYP2D6) ultrarapid metabolism: implications for breastfeeding women taking codeine.
21173786 2012 Intuitive pharmacogenetics: spontaneous risperidone dosage is related to CYP2D6, CYP3A5 and ABCB1 genotypes.
21140323 2010 [Chronic dizziness in a pain patient--pharmacogenomic identification of tramadol as cause].
21135868 2012 CYP2D6 genotype and debrisoquine hydroxylation phenotype in Cubans and Nicaraguans.
21108610 2010 Analysis of CYP2C9*2, CYP2C19*2, and CYP2D6*4 polymorphisms in patients with type 2 diabetes mellitus.
21072184 2010 Flavopiridol pharmacogenetics: clinical and functional evidence for the role of SLCO1B1/OATP1B1 in flavopiridol disposition.
21071160 2011 Analysis of 50 SNPs in CYP2D6, CYP2C19, CYP2C9, CYP3A4 and CYP1A2 by MALDI-TOF mass spectrometry in Chinese Han population.
21063774 2011 Domperidone treatment for gastroparesis: demographic and pharmacogenetic characterization of clinical efficacy and side-effects.
20970553 2010 Toward personalized medicine in renal transplantation.
20925579 2010 Association of CYP2D6 single-nucleotide polymorphism with response to ophthalmic timolol in primary open-angle Glaucoma--a pilot study.
20881950 2010 Assessment of activity levels for CYP2D6*1, CYP2D6*2, and CYP2D6*41 genes by population pharmacokinetics of dextromethorphan.
20878561 2011 Genetic polymorphisms of metabolic enzymes-CYP1A1, CYP2D6, GSTM1, and GSTT1, and gastric carcinoma susceptibility.
20877302 2012 CYP2D6 polymorphism in patients with eating disorders.
20877299 2011 Cytochrome P450 testing for prescribing antipsychotics in adults with schizophrenia: systematic review and meta-analyses.
20863179 2010 Will a new genotyping test help the clinician predict response to antidepressant drugs?
20859244 2011 Role of cytochrome P4502D6 functional polymorphisms in the efficacy of donepezil in patients with Alzheimer's disease.
20857895 2010 Prevalence of CYP450 gene variations in patients with type 2 diabetes.
20851451 2010 Genetic polymorphism of CYP2D6?2 C?T 2850, GSTM1, NQO1 genes and their correlation with biomarkers in manganese miners of Central India.
20849243 2010 Impact of CYP2D6*4 genotype on progression free survival in tamoxifen breast cancer treatment.
20846929 2010 Intronic polymorphisms of cytochromes P450.
20828547 2010 Robust CYP2D6 genotype assay including copy number variation using multiplex single-base extension for Asian populations.
20827267 2010 Estrogen receptor genotypes, menopausal status, and the effects of tamoxifen on lipid levels: revised and updated results.
20814331 2010 Effects of CYP2D6 genotype on the pharmacokinetics, pharmacodynamics, and safety of risperidone in healthy volunteers.
20809362 2011 Comprehensive CYP2D6 genotype and adherence affect outcome in breast cancer patients treated with tamoxifen monotherapy.
20799519 2010 Genetic variants of the drug-metabolizing enzyme CYP2D6 in Puerto Rican psychiatry patients: a preliminary report and potential implications for breast cancer patients.
20731819 2010 CYP2D6 gene variants: association with breast cancer specific survival in a cohort of breast cancer patients from the United Kingdom treated with adjuvant tamoxifen.
20727252 2010 Cytochrome P450-2D6 extensive metabolizers are more vulnerable to methamphetamine-associated neurocognitive impairment: preliminary findings.
20701904 2010 Early life environment, neurodevelopment and the interrelation with atopy.
20700584 2010 Limited effects of frequent CYP2D6*36-*10 tandem duplication allele on in vivo dextromethorphan metabolism in a Japanese population.
20686235 2010 Population pharmacokinetics of R- and S-carvedilol in Japanese patients with chronic heart failure.
20684753 2010 No influence of the polymorphisms CYP2C19 and CYP2D6 on the efficacy of cyclophosphamide, thalidomide, and bortezomib in patients with Multiple Myeloma.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20656072 2011 Flexibility of human cytochrome P450 enzymes: molecular dynamics and spectroscopy reveal important function-related variations.
20656020 2010 Maternal fine particulate matter exposure, polymorphism in xenobiotic-metabolizing genes and offspring birth weight.
20643254 2010 Relation of ADRB1, CYP2D6, and UGT1A1 polymorphisms with dose of, and response to, carvedilol or metoprolol therapy in patients with chronic heart failure.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628863 2010 Methylation patterns of genes coding for drug-metabolizing enzymes in tamoxifen-resistant breast cancer tissues.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20599499 2010 A population pharmacokinetic evaluation of the influence of CYP2D6 genotype on risperidone metabolism in patients with acute episode of schizophrenia.
20597905 2010 Elucidation of CYP2D6 genetic diversity in a unique African population: implications for the future application of pharmacogenetics in the Xhosa population.
20590588 2010 Genetic polymorphisms and drug interactions modulating CYP2D6 and CYP3A activities have a major effect on oxycodone analgesic efficacy and safety.
20590587 2010 The effects of CYP2D6 and CYP3A activities on the pharmacokinetics of immediate release oxycodone.
20588073 2010 Influence of CYP2D6 deletion, multiplication, -1584C-->G, 31G-->A and 2988G-->a gene polymorphisms on dextromethorphan metabolism among Mexican tepehuanos and mestizos.
20574415 2010 Lessons for pharmacogenomics studies: association study between CYP2D6 genotype and tamoxifen response.
20565970 2010 Associations between tamoxifen, estrogens, and FSH serum levels during steady state tamoxifen treatment of postmenopausal women with breast cancer.
20563569 2010 The role of CYP2D6 and ABCB1 pharmacogenetics in drug-naïve patients with first-episode schizophrenia treated with risperidone.
20547595 2011 CYP2D6 genotype and smoking influence fluvoxamine steady-state concentration in Japanese psychiatric patients: lessons for genotype-phenotype association study design in translational pharmacogenetics.
20531370 2011 Association between CYP2C19*17 and metabolism of amitriptyline, citalopram and clomipramine in Dutch hospitalized patients.
20530222 2010 Effect of the CYP2D6*10 genotype on tolterodine pharmacokinetics.
20520586 2010 Evolution of detoxifying systems: the role of environment and population history in shaping genetic diversity at human CYP2D6 locus.
20515869 2010 CYP2D6 polymorphisms as predictors of outcome in breast cancer patients treated with tamoxifen: expanded polymorphism coverage improves risk stratification.
20492431 2010 Can the genotype or phenotype of two polymorphic drug metabolising cytochrome P450-enzymes identify oral lichenoid drug eruptions?
20489028 2011 Effects of commonly administered agents and genetics on nebivolol pharmacokinetics: drug-drug interaction studies.
20473659 2010 Discovery of the nonfunctional CYP2D6 31 allele in Spanish, Puerto Rican, and US Hispanic populations.
20467479 2010 A penalized mixture model approach in genotype/phenotype association analysis for quantitative phenotypes.
20461808 2010 A case-control study of Parkinson's disease and tobacco use: gene-tobacco interactions.
20459744 2010 Cyclophosphamide-metabolizing enzyme polymorphisms and survival outcomes after adjuvant chemotherapy for node-positive breast cancer: a retrospective cohort study.
20456744 2010 Relationship of CYP2D6 genetic polymorphisms and the pharmacokinetics of tramadol in Chinese volunteers.
20454926 2010 Cytochrome P450 2D6 and outcomes of adjuvant tamoxifen therapy: results of a meta-analysis.
20435235 2010 Changes in the QTc interval after administration of flecainide acetate, with and without coadministered paroxetine, in relation to cytochrome P450 2D6 genotype: data from an open-label, two-period, single-sequence crossover study in healthy Korean male subjects.
20432045 2011 Fatal venlafaxine poisonings are associated with a high prevalence of drug interactions.
20430047 2010 Biological definition of multiple chemical sensitivity from redox state and cytokine profiling and not from polymorphisms of xenobiotic-metabolizing enzymes.
20421845 2010 Differential quantification of CYP2D6 gene copy number by four different quantitative real-time PCR assays.
20385997 2010 Effect of concomitant CYP2D6 inhibitor use and tamoxifen adherence on breast cancer recurrence in early-stage breast cancer.
20375710 2010 Polymorphisms in xenobiotic metabolizing enzymes and diet influence colorectal adenoma risk.
20373852 2010 Microarray-based detection of CYP1A1, CYP2C9, CYP2C19, CYP2D6, GSTT1, GSTM1, MTHFR, MTRR, NQO1, NAT2, HLA-DQA1, and AB0 allele frequencies in native Russians.
20368706 2011 CYP2D6 in the brain: genotype effects on resting brain perfusion.
20364044 2010 Association of polymorphism in cytochrome P450 2D6 and N-acetyltransferase-2 with Parkinson's disease.
20350136 2010 Genetic polymorphisms of cytochrome P450 enzymes influence metabolism of the antidepressant escitalopram and treatment response.
20335142 2010 [Association of cytochrome P4502D6 gene polymorphism with the susceptibility of heroin spongiform leucoencephalopathy].
20332423 2010 Effect of CYP2D6, CYP3A5, and MDR1 genetic polymorphisms on the pharmacokinetics of risperidone and its active moiety.
20309015 2011 Efficacy of tamoxifen based on cytochrome P450 2D6, CYP2C19 and SULT1A1 genotype in the Italian Tamoxifen Prevention Trial.
20305604 2010 The role of CYP2D6 and TaqI A polymorphisms in malignant neuroleptic syndrome: two case reports with three episodes.
20297661 2010 [Analysis of genetic predisposition to pulmonary tuberculosis in native Russians].
20225176 2010 [Risperidone intoxication in a patient with a genetic predisposition as "poor [non]metabolizer"].
20206139 2010 Effects of monoamine oxidase inhibitor and cytochrome P450 2D6 status on 5-methoxy-N,N-dimethyltryptamine metabolism and pharmacokinetics.
20205348 2010 CYP2D6 polymorphism screening in a selected population of Spain (La Alpujarra): no effect of geographical isolation.
20201714 2010 Cytochrome P450 2D6 polymorphism and drug utilization in patients with oral lichen planus.
20195825 2010 The effects of puerarin on CYP2D6 and CYP1A2 activities in vivo.
20185366 2010 Genetic susceptibility factors for multiple chemical sensitivity revisited.
20174590 2009 Response to serotonin reuptake inhibitors in OCD is not influenced by common CYP2D6 polymorphisms.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20147896 2010 A phenotype-genotype approach to predicting CYP450 and P-glycoprotein drug interactions with the mixed inhibitor/inducer tipranavir/ritonavir.
20137387 2009 [Association between CYP2B6, CYP2D6, GSTP1 genetic polymorphisms and urinary styrene metabolites in professional workers].
20136364 2010 Errors and reproducibility of DNA array-based detection of allelic variants in ADME genes: PHARMAchip.
20133509 2010 CYP3A5 but not CYP2D6 polymorphism contributes significantly to the variability in dextropropoxyphene disposition.
20124171 2010 Significant effect of polymorphisms in CYP2D6 and ABCC2 on clinical outcomes of adjuvant tamoxifen therapy for breast cancer patients.
20118554 2010 Effects of cigarette smoking and cytochrome P450 2D6 genotype on fluvoxamine concentration in plasma of Japanese patients.
20081063 2010 Composite functional genetic and comedication CYP2D6 activity score in predicting tamoxifen drug exposure among breast cancer patients.
20075642 2010 Effects of the serotonin 1A, 2A, 2C, 3A, and 3B and serotonin transporter gene polymorphisms on the occurrence of paroxetine discontinuation syndrome.
20041956 2010 Lack of association between schizophrenia and polymorphisms in dopamine metabolism and transport genes.
20031551 2008 Pharmacogenetic predictors of statin-mediated low-density lipoprotein cholesterol reduction and dose response.
20009880 2009 CYP1A1 and CYP2D6 gene polymorphisms in Israeli Jewish women with cervical cancer.
20007670 2010 Identification of cytochrome P450 isoforms involved in the metabolism of paroxetine and estimation of their importance for human paroxetine metabolism using a population-based simulator.
19997080 2010 Pharmacogenetics of risperidone therapy in autism: association analysis of eight candidate genes with drug efficacy and adverse drug reactions.
19995332 2009 Difference in desipramine metabolic profile between wild-type and CYP2D6-humanized mice.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19954746 2010 Interaction of drug metabolizing cytochrome P450 2D6 poor metabolizers with cytochrome P450 2C9 and 2C19 genotypes modify the susceptibility to head and neck cancer and treatment response.
19954080 CYP2D6 genotypes in Puerto Rican psychiatry patients with intolerance of antidepressants and antipsychotics.
19953095 2010 Lack of association between oestrogen receptor polymorphisms and change in bone mineral density with tamoxifen therapy.
19947517 [The effect of polymorphism of genes of xenobiotics detoxication on the frequencies of spontaneous and induced chromosome aberrations in human lymphocytes].
19946748 2010 CYP2D6*4, CYP3A5*3 and ABCB1 3435T polymorphisms and drug-related falls in elderly people.
19940985 2010 Influence of the CYP2D6 polymorphism and hemodialysis on codeine disposition in patients with end-stage renal disease.
19937844 2009 Probabilistic prediction of the human CYP3A4 and CYP2D6 metabolism sites.
19910717 2009 Impact of CYP2D6 genotype on steady-state serum concentrations of risperidone and 9-hydroxyrisperidone in patients using long-acting injectable risperidone.
19907421 2010 High frequency of occurrence of CYP2D6 gene duplication/multiduplication indicating ultrarapid metabolism among suicide cases.
19902987 2009 Polymorphism of human cytochrome P450 2D6 and its clinical significance: part II.
19892789 2010 Genetic association of phase I and phase II detoxification genes with recurrent miscarriages among North Indian women.
19891553 2009 Genetic polymorphisms of drug-metabolizing enzymes and anti-TB drug-induced hepatitis.
19887477 2009 Randomized biomarker trial of anastrozole or low-dose tamoxifen or their combination in subjects with breast intraepithelial neoplasia.
19866496 2009 Genetic matters of CYP2D6 in breast cancer: copy number variations and nucleotide polymorphisms.
19840783 2010 Evaluation of the influence of sex and CYP2C19 and CYP2D6 polymorphisms in the disposition of citalopram.
19833260 2009 The SLCO1B1*5 genetic variant is associated with statin-induced side effects.
19823875 2010 Molecular genetics and epigenetics of the cytochrome P450 gene family and its relevance for cancer risk and treatment.
19809024 2009 Association between CYP2D6 polymorphisms and outcomes among women with early stage breast cancer treated with tamoxifen.
19797609 2010 Exploration of catalytic properties of CYP2D6 and CYP3A4 through metabolic studies of levorphanol and levallorphan.
19781968 2010 Identification of genetic variants of human cytochrome P450 2D6 with impaired mitochondrial targeting.
19761369 2009 Molecular diversity at the CYP2D6 locus in healthy and schizophrenic southern Brazilians.
19738170 2009 Effect of a CYP2D6 polymorphism on the efficacy of donepezil in patients with Alzheimer disease.
19719813 2010 Impact of the CYP2D6 genotype on post-operative intravenous oxycodone analgesia.
19715474 2009 Frequency of five important CYP2D6 alleles within an Iranian population (Eastern Azerbaijan).
19710642 2009 Escitalopram is a weak inhibitor of the CYP2D6-catalyzed O-demethylation of (+)-tramadol but does not reduce the hypoalgesic effect in experimental pain.
19710640 2009 Risk to the breast-fed neonate from codeine treatment to the mother: a quantitative mechanistic modeling study.
19702490 2009 Drug-metabolizing enzyme genotypes and aggressive behavior treatment response in hospitalized pediatric psychiatric patients.
19694742 2009 Variation in the CYP2D6 gene is associated with a lower serum sodium concentration in patients on antidepressants.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19660006 2009 Effects of CYP2D6 genotypes on age-related change of flecainide metabolism: involvement of CYP1A2-mediated metabolism.
19656108 2009 [Efficacy and safety of bisoprolol in pregnant women with chronic arterial hypertension do not depend on genetic CYP2D6 polymorphism].
19652678 2009 The CYP2D6 metaboliser status of patients prescribed risperidone for the treatment of psychosis.
19651758 2009 Hepatic cytochrome P450 enzyme alterations in humans with progressive stages of nonalcoholic fatty liver disease.
19636337 2009 Genetic polymorphism, linkage disequilibrium, haplotype structure and novel allele analysis of CYP2C19 and CYP2D6 in Han Chinese.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19604091 2009 Utilization of pharmacogenomics and therapeutic drug monitoring for opioid pain management.
19604084 2009 Relation between CYP2D6 genotype, personality, neurocognition and overall psychopathology in healthy volunteers.
19604081 2009 Relevance of CYP2D6 -1584C>G polymorphism for thioridazine:mesoridazine plasma concentration ratio in psychiatric patients.
19597703 2009 Prevalent breast cancer patients with a homozygous mutant status for CYP2D6*4: response and biomarkers in tamoxifen users.
19596663 2009 No association between CYP2D6*10 genotype and survival of node-negative Japanese breast cancer patients receiving adjuvant tamoxifen treatment.
19593802 2010 Role of the CYP2D6, EPHX1, MPO, and NQO1 genes in the susceptibility to acute lymphoblastic leukemia in Brazilian children.
19593180 2009 Venlafaxine metabolism as a marker of cytochrome P450 enzyme 2D6 metabolizer status.
19593168 2009 ABCB1 and cytochrome P450 polymorphisms: clinical pharmacogenetics of clozapine.
19593158 2009 Cytochrome P450 CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes are not associated with response and remission in a sample of depressive patients.
19575027 2009 Genetic variation of genes for xenobiotic-metabolizing enzymes and risk of bronchial asthma: the importance of gene-gene and gene-environment interactions for disease susceptibility.
19537956 2009 CYP1A1 genotype modifies the impact of smoking on effectiveness of HAART among women.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19523031 The impact of CYP2D6 genetic polymorphisms on postoperative morphine consumption.
19521114 2009 CYP2D6 genotype predicts antipsychotic side effects in schizophrenia inpatients: a retrospective matched case-control study.
19512959 2009 Cytochrome P450 2D6.
19474452 2009 Perioperative genomic profiles using structure-specific oligonucleotide probes.
19470220 2009 Biotechnological synthesis of the designer drug metabolite 4'-hydroxymethyl-alpha-pyrrolidinohexanophenone in fission yeast heterologously expressing human cytochrome P450 2D6--a versatile alternative to multistep chemical synthesis.
19448135 2009 CYP2D6-CYP2C9 protein-protein interactions and isoform-selective effects on substrate binding and catalysis.
19444434 2009 Genetic polymorphisms of CYP2D6 oxidation in patients with systemic sclerosis.
19438707 2009 Human liver mitochondrial cytochrome P450 2D6--individual variations and implications in drug metabolism.
19437119 2010 Genetic polymorphisms of CYP2D6 oxidation in patients with inflammatory bowel disease.
19429471 2009 Influence of sex and CYP2D6 genotype on mirtazapine disposition, evaluated in Spanish healthy volunteers.
19421167 2009 Cytochrome P450 2D6 activity predicts discontinuation of tamoxifen therapy in breast cancer patients.
19405050 2009 Characterization of pharmacogenetically relevant CYP2D6 and ABCB1 gene polymorphisms in a Portuguese population sample.
19395173 2009 Can extremely low or high morphine formation from codeine be predicted prior to therapy initiation?
19387994 2009 Effects of the CYP2D6*10 alleles and co-medication with CYP2D6-dependent drugs on risperidone metabolism in patients with schizophrenia.
19387424 2009 A haplotype of the norepinephrine transporter (Net) gene Slc6a2 is associated with clinical response to atomoxetine in attention-deficit hyperactivity disorder (ADHD).
19374513 2009 Association between the CYP2D6*4 polymorphism and depression or anxiety in the elderly.
19365402 2009 CYP2D6 genotype and its relationship with metoprolol dose, concentrations and effect in patients with systolic heart failure.
19364831 2009 Discovery of novel functional variants and extensive evaluation of CYP2D6 genetic polymorphisms in Koreans.
19357842 2009 The pharmacokinetics of codeine and its metabolites in Blacks with sickle cell disease.
19356055 2007 Allelic variations in CYP2D6 gene and susceptibility to cervical cancer.
19350405 2009 Population study of genetic polymorphisms and superficial bladder cancer risk in Han-Chinese smokers in Shanghai.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19330589 2009 Polymorphisms in genes encoding drugs and xenobiotic metabolizing enzymes in a Brazilian population.
19320528 2009 Cytochrome P450 2D6 genotyping: potential role in improving treatment outcomes in psychiatric disorders.
19308365 2009 O-demethylation of codeine to morphine inhibited by low-dose levomepromazine.
19303860 2009 Determination of CYP2D6 gene copy number by multiplex polymerase chain reaction analysis.
19296901 2009 TaqMan real-time PCR quantification strategy of CYP2D6 gene copy number for the LightCycler 2.0.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
19284319 2009 Cytochrome oxidase 2D6 gene polymorphism in primary open-angle glaucoma with various effects to ophthalmic timolol.
19242697 2009 Frequency of mutated allele CYP2D6*4 in the Turkish ankylosing spondylitis patients and healthy controls.
19225771 2009 Effect of smoking and CYP2D6 polymorphisms on the extent of fluvoxamine-alprazolam interaction in patients with psychosomatic disease.
19219857 2009 Genetic association studies of methamphetamine use disorders: A systematic review and synthesis.
19219744 2009 Acetaminophen bioactivation by human cytochrome P450 enzymes and animal microsomes.
19194367 2008 Clinical significance of CYP2D6 polymorphisms and tamoxifen in women with breast cancer.
19192051 2009 Polymorphic drug metabolizing CYP-enzymes--a pathogenic factor in oral lichen planus?
19189212 2009 The CYP2D6*4 polymorphism affects breast cancer survival in tamoxifen users.
19189210 2010 Impact of CYP2D6 polymorphisms in tamoxifen adjuvant breast cancer treatment.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19169185 2009 DNA microarray technology in the clinical environment: the AmpliChip CYP450 test for CYP2D6 and CYP2C19 genotyping.
19164093 2009 Novel variants of major drug-metabolising enzyme genes in diverse African populations and their predicted functional effects.
19162321 2009 Polymorphisms of xenobiotic metabolizing enzymes and DNA repair genes and outcome in childhood acute lymphoblastic leukemia.
19156902 2009 Genetic polymorphisms of CYP2D6 10 and CYP2C19 2, 3 are not associated with prognosis, endometrial thickness, or bone mineral density in Japanese breast cancer patients treated with adjuvant tamoxifen.
19153830 2009 Association between CYP2D6 genotype and tamoxifen-induced hot flashes in a prospective cohort.
19151603 2009 Pharmacogenetic variation at CYP2C9, CYP2C19, and CYP2D6 at global and microgeographic scales.
19142106 2009 Comparison of the pharmacokinetics of venlafaxine extended release and desvenlafaxine in extensive and poor cytochrome P450 2D6 metabolizers.
19095219 2009 Variation in catechol-O-methyltransferase is associated with duloxetine response in a clinical trial for major depressive disorder.
19094446 Effects of polymorphism of the beta(1) adrenoreceptor and CYP2D6 on the therapeutic effects of metoprolol.
19082882 2009 Estrogen receptor genotype is associated with risk of venous thromboembolism during tamoxifen therapy.
19071885 2009 Steady-state concentrations of mirtazapine, N-desmethylmirtazapine, 8-hydroxymirtazapine and their enantiomers in relation to cytochrome P450 2D6 genotype, age and smoking behaviour.
19047159 2008 A polymorphism in the TC21 promoter associates with an unfavorable tamoxifen treatment outcome in breast cancer.
19037197 2009 Impact of the CYP2D6 genotype on the clinical effects of metoprolol: a prospective longitudinal study.
19033450 2009 CYP2C19 genotype is a major factor contributing to the highly variable pharmacokinetics of voriconazole.
19032724 2008 Population pharmacokinetic modelling of aripiprazole and its active metabolite, dehydroaripiprazole, in psychiatric patients.
19025845 2000 Drug metabolism genotypes and their association with adverse drug reactions in selected populations: a pilot study of methodology.
19024387 2008 [CYP2D6*10 polymorphisms and lung cancer susceptibility].
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19001559 2009 The effects of desvenlafaxine and paroxetine on the pharmacokinetics of the cytochrome P450 2D6 substrate desipramine in healthy adults.
19000940 2008 Correlates of response to Olanzapine in a North Indian Schizophrenia sample.
19000552 2008 Effect of CYP2D6 polymorphism on pharmacokinetics of a novel ACAT inhibitor, pactimibe and its unique metabolite, R-125528.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18979093 2009 Pharmacogenomics of CYP2A6, CYP2B6, CYP2C19, CYP2D6, CYP3A4, CYP3A5 and MDR1 in Vietnam.
18978520 2008 Dose-dependent effect of the CYP2D6 genotype on the steady-state fluvoxamine concentration.
18958918 [Prevalence of ultraextensive drug metabolizers in Croatian population--long-PCR based detection of amplified CYP2D6 gene].
18927241 2009 Pharmacokinetics of novel atrial-selective antiarrhythmic agent vernakalant hydrochloride injection (RSD1235): influence of CYP2D6 expression and other factors.
18840375 2008 Six-month, prospective, longitudinal, open-label caffeine and dextromethorphan phenotyping study in children with growth hormone deficiency receiving recombinant human growth hormone replacement.
18834373 2008 Influence of CYP2D6*10 on the pharmacokinetics of metoprolol in healthy Korean volunteers.
18827765 2008 CYP 2D6 polymorphism and antipsychotic therapy.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18797858 2009 Identification of a novel non-functional CYP2D6 allele, CYP2D6*69, in a Caucasian poor metabolizer individual.
18794105 2008 Impaired tamoxifen metabolism reduces survival in familial breast cancer patients.
18794098 2008 Cytochrome P450 2D6 and homeobox 13/interleukin-17B receptor: combining inherited and tumor gene markers for prediction of tamoxifen resistance.
18784654 2009 Genetic variation in the CYP2D6 gene is associated with a lower heart rate and blood pressure in beta-blocker users.
18784265 2008 Functional characterization of 17 CYP2D6 allelic variants (CYP2D6.2, 10, 14A-B, 18, 27, 36, 39, 47-51, 53-55, and 57).
18754843 2008 Pharmacokinetic interaction of flecainide and paroxetine in relation to the CYP2D6*10 allele in healthy Korean subjects.
18728242 2008 Evaluation of a [13C]-dextromethorphan breath test to assess CYP2D6 phenotype.
18725510 2008 The molecular basis of CYP2D6-mediated N-dealkylation: balance between metabolic clearance routes and enzyme inhibition.
18719619 2009 Pharmacogenetics of neonatal opioid toxicity following maternal use of codeine during breastfeeding: a case-control study.
18713907 2008 Respiratory depression with tramadol in a patient with renal impairment and CYP2D6 gene duplication.
18708991 2008 ABCB1 polymorphisms influence steady-state plasma levels of 9-hydroxyrisperidone and risperidone active moiety.
18698000 2008 The endocannabinoid anandamide is a substrate for the human polymorphic cytochrome P450 2D6.
18690546 2009 CYP1A2, CYP2D6, GSTM1, GSTP1, and GSTT1 gene polymorphisms in patients with bladder cancer in a Turkish population.
18681789 2008 Is pharmacogenomics our future? Metformin, ovulation and polymorphism of the STK11 gene in polycystic ovary syndrome.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18666237 2008 Genetic polymorphism of hepatocyte nuclear factor-4alpha influences human cytochrome P450 2D6 activity.
18663559 2009 Taurine in plasma and CSF: a study in healthy male volunteers.
18648788 2008 CYP2D6 is a major determinant of metoprolol disposition and effects in hospitalized Russian patients treated for acute myocardial infarction.
18641553 2008 CYP2D6 and ABCB1 genetic variability: influence on paroxetine plasma level and therapeutic response.
18632250 2008 Systematic polymorphism analysis of the CYP2D6 gene in four different geographical Han populations in mainland China.
18625943 2008 Intraocular pressure response to topical beta-blockers associated with an ADRB2 single-nucleotide polymorphism.
18618215 2008 Genetic polymorphisms in oestrogen metabolic pathway and breast cancer: a positive association with combined CYP/GST genotypes.
18597648 2008 Relation between CYP2D6 phenotype and genotype and personality in healthy volunteers.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18553077 2008 Semi-quantitative CYP2D6 gene doses in relation to metabolic ratios of psychotropics.
18551040 2008 Naturalistic pharmacogenetic study of treatment resistance to typical neuroleptics in European-Brazilian schizophrenics.
18547414 2008 Genotyping panel for assessing response to cancer chemotherapy.
18545991 2008 Enantiospecific pharmacokinetics of metoprolol in CYP2D6 ultra-rapid metabolizers and correlation with exercise-induced heart rate.
18543297 2009 Metabolism of dextrorphan by CYP2D6 in different recombinantly expressed systems and its implications for the in vitro assessment of dextromethorphan metabolism.
18520597 2008 CYP2D6 polymorphism in relation to tramadol metabolism: a study of faroese patients.
18520596 2008 The impact of CYP2D6 and CYP2C19 polymorphisms on suicidal behavior and substance abuse disorder among patients with schizophrenia: a retrospective study.
18480698 2008 Aripiprazole-induced parkinsonism and its association with dopamine and serotonin receptor polymorphisms.
18474679 2008 Developmental changes in human liver CYP2D6 expression.
18474629 2008 Breaking tolerance to the natural human liver autoantigen cytochrome P450 2D6 by virus infection.
18445827 2008 Pharmacogenomic variation of CYP2D6 and the choice of optimal adjuvant endocrine therapy for postmenopausal breast cancer: a modeling analysis.
18433425 2008 Relationship of cytochrome P450 pharmacogenetics to the effects of yohimbine on gastrointestinal transit and catecholamines in healthy subjects.
18429752 2008 [Genetic aspects of individual sensitivity to betaxolol in patients with arterial hypertension].
18425996 2008 Identification of CYP2D6 null variants among long-stay, chronic psychiatric inpatients: is it strictly necessary?
18425152 2008 Allele frequency differences of cytochrome P450 polymorphisms in a sample of New Zealand M?ori.
18423013 2008 Implication of Xenobiotic Metabolizing Enzyme gene (CYP2E1, CYP2C19, CYP2D6, mEH and NAT2) polymorphisms in breast carcinoma.
18414197 2008 Genetic polymorphisms of metabolic enzymes CYP1A1, CYP2D6, GSTM1 and GSTT1 and leukemia susceptibility.
18407954 2008 Association between CYP2D6 *10 genotype and survival of breast cancer patients receiving tamoxifen treatment.
18401578 2008 The effect of paroxetine on the pharmacokinetics, safety, and tolerability of ramosetron in healthy subjects.
18384443 2008 Effects of imatinib (Glivec) on the pharmacokinetics of metoprolol, a CYP2D6 substrate, in Chinese patients with chronic myelogenous leukaemia.
18382661 2008 Pharmacokinetic genes do not influence response or tolerance to citalopram in the STAR*D sample.
18372530 1997 The CYP2D6 extensive metabolizer genotype is associated with increased risk for bladder cancer.
18356043 2008 Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone.
18346782 2008 Molecular modelling of human CYP2D6 and molecular docking of a series of ajmalicine- and quinidine-like inhibitors.
18346175 2008 Cyp2d6*3, *4, *5 and *6 polymorphisms and antipsychotic-induced extrapyramidal side-effects in patients receiving antipsychotic therapy.
18327668 2008 Polymorphism in environment responsive genes and association with Parkinson disease.
18317231 2008 Postmenstrual age and CYP2D6 polymorphisms determine tramadol o-demethylation in critically ill neonates and infants.
18304900 2008 The role of CYP2D6*4 variant in bladder cancer susceptibility in Tunisian patients.
18300942 2008 Genetic predisposition to Parkinson's disease: CYP2D6 and HFE in the Faroe Islands.
18294285 2008 Impact of CYP2D6*10 on recurrence-free survival in breast cancer patients receiving adjuvant tamoxifen therapy.
18287869 2008 Association of cytochrome P450, glutathione S-transferase and N-acetyl transferase 2 gene polymorphisms with incidence of acute myeloid leukemia.
18280655 2008 Reduced CYP2D6 activity is a negative risk factor for methamphetamine dependence.
18261353 2007 [Combined effects of genetic polymorphisms in cytochrome P450s and GSTM1 on lung cancer susceptibility].
18258609 2008 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of non-small cell lung cancer in smokers.
18240905 2007 CYP2C9, CYP2C19 and CYP2D6 allele frequencies in the Ashkenazi Jewish population.
18231117 2008 Pharmacokinetics/genotype associations for major cytochrome P450 enzymes in native and first- and third-generation Japanese populations: comparison with Korean, Chinese, and Caucasian populations.
18223460 2008 The relationship between the response of clinical symptoms and plasma olanzapine concentration, based on pharmacogenetics: Juntendo University Schizophrenia Projects (JUSP).
18214849 2008 Clinical assessment of CYP2D6-mediated herb-drug interactions in humans: effects of milk thistle, black cohosh, goldenseal, kava kava, St. John's wort, and Echinacea.
18214456 2008 Serum concentrations of venlafaxine and its metabolites O-desmethylvenlafaxine and N-desmethylvenlafaxine in heterozygous carriers of the CYP2D6*3, *4 or *5 allele.
18211048 2008 Novel hierarchical classification and visualization method for multiobjective optimization of drug properties: application to structure-activity relationship analysis of cytochrome P450 metabolism.
18204346 2008 Effects of the CYP2D6 gene duplication on the pharmacokinetics and pharmacodynamics of tramadol.
18202841 2008 The CYP2D6 gene locus in South African Coloureds: unique allele distributions, novel alleles and gene arrangements.
18197300 2008 Exogenous and endogenous determinants of blood trihalomethane levels after showering.
18183034 2008 Effect of an antiretroviral regimen containing ritonavir boosted lopinavir on intestinal and hepatic CYP3A, CYP2D6 and P-glycoprotein in HIV-infected patients.
18167502 2008 Propafenone for the prevention of atrial tachyarrhythmias after cardiac surgery: a randomized, double-blind placebo-controlled trial.
18165569 2008 The effect of a long term epidural infusion of ropivacaine on CYP2D6 activity.
18086475 2008 Gene polymorphism influencing treatment response in psychotic patients in a naturalistic setting.
18075468 2007 CYP2D6 and DRD2 genes differentially impact pharmacodynamic sensitivity and time course of prolactin response to perphenazine.
18070221 2008 Influence of the CYP2D6*4 polymorphism on dose, switching and discontinuation of antidepressants.
18061941 2008 Polymorphisms in xenobiotic-metabolizing genes and the risk of chronic lymphocytic leukemia and non-Hodgkin's lymphoma in adult Russian patients.
18048313 2007 Pharmacogenomics: analysing SNPs in the CYP2D6 gene using amino acid properties.
18034624 2007 CYP2D6 polymorphism: implications for antipsychotic drug response, schizophrenia and personality traits.
18024866 2007 Breast cancer treatment outcome with adjuvant tamoxifen relative to patient CYP2D6 and CYP2C19 genotypes.
17992535 2008 Correlation of inter-individual variations of amitriptyline metabolism examined in hairs with CYP2C19 and CYP2D6 polymorphisms.
17971818 2008 The CYP2D6 activity score: translating genotype information into a qualitative measure of phenotype.
17966194 2007 [Genotyping of CYP2D6 and CYP2C19].
17965522 2007 UGT2B7*3 did not affect the pharmacokinetics of R- and S-carvedilol in healthy Japanese.
17965519 2007 Pharmacokinetics of aripiprazole, a new antipsychotic, following oral dosing in healthy adult Japanese volunteers: influence of CYP2D6 polymorphism.
17957765 2008 Structural rationalization of novel drug metabolizing mutants of cytochrome P450 BM3.
17947222 2008 Effects of CYP2D6 and SULT1A1 genotypes including SULT1A1 gene copy number on tamoxifen metabolism.
17921051 2008 Effect of tolterodine on sleep structure modulated by CYP2D6 genotype.
17909762 2007 Rapid genotyping of CYP2D6, CYP2C19 and TPMT polymorphisms by primer extension reaction in a dipstick format.
17908053 2007 Pharmacogenetic aspects of therapy with cholinesterase inhibitors: the role of CYP2D6 in Alzheimer's disease pharmacogenetics.
17882159 2008 Tamoxifen pharmacogenomics: the role of CYP2D6 as a predictor of drug response.
17828532 2007 Impact of the CYP2D6 genotype on steady-state serum concentrations of aripiprazole and dehydroaripiprazole.
17803873 2007 Cytochrome P450 2D6 genotype variation and venlafaxine dosage.
17764479 2008 The CYP2D6 polymorphism in relation to the metabolism of amitriptyline and nortriptyline in the Faroese population.
17761971 2007 Clinical implications of CYP2D6 genotypes predictive of tamoxifen pharmacokinetics in metastatic breast cancer.
17725248 2007 Lack of influence of CYP2D6 genotype on the clearance of (R)-, (S)- and racemic-methadone.
17715206 2007 Serum prolactin levels, plasma risperidone levels, polymorphism of cytochrome P450 2D6 and clinical response in patients with schizophrenia.
17714084 2007 Simultaneous genotyping of CYP2D6*3, *4, *5 and *6 polymorphisms in a Spanish population through multiplex long polymerase chain reaction and minisequencing multiplex single base extension analysis.
17713466 2008 Estrogen receptor genotypes, menopausal status, and the lipid effects of tamoxifen.
17701031 2007 Effects of CYP2D6 polymorphisms on neuroleptic malignant syndrome.
17700359 2007 CYP2D6*4 polymorphism is associated with statin-induced muscle effects.
17697394 2008 Genetic polymorphisms in the 5-hydroxytryptamine type 3B receptor gene and paroxetine-induced nausea.
17667959 2008 Association of graded allele-specific changes in CYP2D6 function with imipramine dose requirement in a large group of depressed patients.
17667795 2007 Depot haloperidol treatment in outpatients with schizophrenia on monotherapy: impact of CYP2D6 polymorphism on pharmacokinetics and treatment outcome.
17635183 2007 Association of CYP2D6 and ADRB1 genes with hypotensive and antichronotropic action of betaxolol in patients with arterial hypertension.
17635181 2007 Genetic polymorphisms of drug-metabolizing enzymes CYP2D6, CYP2C9, CYP2C19 and CYP3A5 in the Greek population.
17624022 2007 AmineDB: large scale docking of amines with CYP2D6 and scoring for druglike properties--towards defining the scope of the chemical defense against foreign amines in humans.
17610534 2007 Atomoxetine pharmacokinetics in healthy Chinese subjects and effect of the CYP2D6*10 allele.
17609736 2007 Urinary metabolites to assess in vivo ontogeny of hepatic drug metabolism in early neonatal life.
17581325 2007 Study of genetic polymorphism of xenobiotic enzymes in acute leukemia.
17573783 2008 Endogenous morphine signaling via nitric oxide regulates the expression of CYP2D6 and COMT: autocrine/paracrine feedback inhibition.
17570739 2007 Impact of CYP2D6 genetic polymorphism on tramadol pharmacokinetics and pharmacodynamics.
17568504 2007 [Study of debrisoquine hydroxylation polymorphism (CYP2D6) in the Cuban population compared to Spaniards].
17554527 2007 Genotyping of single nucleotide polymorphisms by primer extension reaction and a dual-analyte bio/chemiluminometric assay.
17547692 2007 Genetic polymorphism of CYP2D6 influences susceptibility to papillary thyroid cancer.
17541883 2007 A study of genetic (CYP2D6 and ABCB1) and environmental (drug inhibitors and inducers) variables that may influence plasma risperidone levels.
17536768 GST CYP and PON1 polymorphisms in farmers attributing ill health to organophosphate-containing sheep dip.
17530572 CYP2D6 gene polymorphism as a probable risk factor for Alzheimer's disease and Parkinson's disease with dementia.
17517247 2007 The effect of CYP2D6 polymorphisms on the response to pain treatment for pediatric sickle cell pain crisis.
17503978 2007 Impact of CYP1A2 and CYP2D6 polymorphisms on drug metabolism and on insulin and lipid elevations and insulin resistance in clozapine-treated patients.
17479406 2007 Genetic polymorphisms in CYP1A1, CYP2D6, UGT1A6, UGT1A7, and SULT1A1 genes and correlation with benzene exposure in a Chinese occupational population.
17470523 2007 Comparative metabolic capabilities and inhibitory profiles of CYP2D6.1, CYP2D6.10, and CYP2D6.17.
17460029 2007 A natural variant of the heme-binding signature (R441C) resulting in complete loss of function of CYP2D6.
17454842 2007 Genotyping of the cytochrome P450 2D6 4469 C>T polymorphism using SimpleProbes.
17450472 2007 CYP450 polymorphisms predict clinic outcomes to vinorelbine-based chemotherapy in patients with non-small-cell lung cancer.
17449559 2007 Gene-environment interactions in parkinsonism and Parkinson's disease: the Geoparkinson study.
17442289 2007 Association of CYP2E1 and NAT2 gene polymorphisms with chronic obstructive pulmonary disease.
17431033 2007 Timolol metabolism in human liver microsomes is mediated principally by CYP2D6.
17418993 2007 Development and full validation of six inhibition assays for five major cytochrome P450 enzymes in human liver microsomes using an automated 96-well microplate incubation format and LC-MS/MS analysis.
17392730 2007 Identification and characterization of CYP2D6*56B, an allele associated with the poor metabolizer phenotype.
17374963 2007 Frequency of mutated allele CYP2D6*4 in the Turkish population.
17361124 2007 Concentrations of tramadol and O-desmethyltramadol enantiomers in different CYP2D6 genotypes.
17329852 2007 Evaluation of effects of polymorphism for metabolic enzymes on pharmacokinetics of carvedilol by population pharmacokinetic analysis.
17325735 2007 Low frequency of CYP2D6 poor metabolizers among schizophrenia patients.
17324244 2007 No association between CYP2D6 polymorphisms and personality trait in Japanese.
17311358 Frequency of single nucleotide polymorphisms of CYP2D6 in the Czech population.
17304721 2007 [Polymorphisms in the genes of cytochrome oxidase P450 2D6 (CYP2D6), paraoxonase 1 (PON1) and apolipoprotein E (APOE) as risk factors for Parkinson's disease].
17301689 2007 CYP2D6 worldwide genetic variation shows high frequency of altered activity variants and no continental structure.
17297618 2007 The effect of Shoseiryuto, a traditional Japanese medicine, on cytochrome P450s, N-acetyltransferase 2 and xanthine oxidase, in extensive or intermediate metabolizers of CYP2D6.
17289397 2007 Tolerability of statins is not linked to CYP450 polymorphisms, but reduced CYP2D6 metabolism improves cholesteraemic response to simvastatin and fluvastatin.
17270484 2007 Polymorphisms of catechol-0-methyltransferase (COMT), monoamine oxidase B (MAOB), N-acetyltransferase 2 (NAT2) and cytochrome P450 2D6 (CYP2D6) gene in patients with early onset of Parkinson's disease.
17259947 2007 Cytochrome P4502D6 (CYP2D6) gene locus heterogeneity: characterization of gene duplication events.
17250723 2007 Association of A313 G polymorphism (GSTP1*B) in the glutathione-S-transferase P1 gene with sporadic Parkinson's disease.
17244352 2007 Genetic variants of CYP3A5, CYP2D6, SULT1A1, UGT2B15 and tamoxifen response in postmenopausal patients with breast cancer.
17242628 2007 CYP2D6 and clinical response to atomoxetine in children and adolescents with ADHD.
17241532 2007 Allelic distributions of CYP2D6 gene copy number variation in the Eastern Han Chinese population.
17234366 2007 Association of CYP2D6 ultrarapid metabolizer genotype with deficient patient satisfaction regarding methadone maintenance treatment.
17225875 CYP2D6 polymorphisms in patients with porphyrias.
17224713 2007 Prolactin release in children treated with risperidone: impact and role of CYP2D6 metabolism.
17194620 2007 Allele and genotype frequencies of metabolic genes in Native Americans from Argentina and Paraguay.
17186005 2007 Frequency of CYP2D6*10 and *14 alleles and their influence on the metabolic activity of CYP2D6 in a healthy Chinese population.
17178267 2006 ABCB1 and cytochrome P450 genotypes and phenotypes: influence on methadone plasma levels and response to treatment.
17115111 2007 The impact of cytochrome P450 2D6 metabolism in women receiving adjuvant tamoxifen.
17113562 2007 Genotyping of eight polymorphic genes encoding drug-metabolizing enzymes and transporters using a customized oligonucleotide array.
17102541 CYP2D6 genotype and phenotype relationship in South Indians.
17089107 2006 Impact of CYP2D6*10 on H1-antihistamine-induced hypersomnia.
17038884 2006 AmpliChip CYP450 GeneChip: a new gene chip that allows rapid and accurate CYP2D6 genotyping.
16960721 2006 Effect of the CYP2D6*10 C188T polymorphism on postoperative tramadol analgesia in a Chinese population.