Property Summary

NCBI Gene PubMed Count 192
PubMed Score 331.06
PubTator Score 396.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Protein-protein Interaction (2)

Gene RIF (183)

PMID Text
26507668 CYP2C8 genetic polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26489615 CYP2C8-derived epoxyeicosatrienoic acids prevented TNF-alpha-induced HUVECs apoptosis via inhibition of oxidative stress associated with the Nrf2 signaling.
26427316 These comprehensive findings could inform for further genotype-phenotype studies on interindividual differences in CYP2C8-mediated drug metabolism
26404779 Significant gene-sex interaction for CYP2C8*3 with twofold increase in the relative risk of essential hypertension and a similar tendency for CYP2J2*7 associated with coronary artery disease without myocardial infarction in Bulgarian males.
26252103 Single nucleotide polymorphisms of CYP2C8,CYP2E1 and CYP4B1 are associated with susceptibility to gout in ethnic Han males population.
26161459 CYP2C8*3 is a gain-of-function polymorphism for imatinib N-demethylation, which appears to be mainly mediated by CYP2C8 and not CYP3A4 in vitro in human liver microsomes
26122864 CYP2C8 polymorphisms affected neither R- nor S-ibuprofen
26115084 the CYP2C8*3 allele has no major impact on paclitaxel metabolism in vitro or of paclitaxel-induced neuropathy
25947240 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke.
25839935 Results show that CYP2C8 rs17110453 and EPHX2 rs751141 two-locus interaction confers a significantly higher risk for ischemic stroke.
25560582 We did not observe any association of CYP2C8*2, CYP2C8*3, CYP2C9*2 and CYP2C9*3 with myocardial infarction
25406731 The present study shows that elevated EET levels in BC tissues are associated with upregulation of CYP2C8, 2C9, and 2J2, and downregulation of sEH, and are also associated with aggressive cell behavior in BC patients.
25388680 Patients with CYP2C8*2C and EPHX2 404del variants had worse long-term outcomes while those with EPHX2 287Gln, CYP2J2*7, and CYP2C9 g.816G variants had favorable outcomes.
25160618 This study suggests that mitochondrially targeted variant 3 CYP2C8 may contribute to oxidative stress in various tissues.
25017038 The CYP2C8 gene may be useful in the prevention and treatment of vascular inflammatory diseases.
24988984 differences in genetic variations and haplotypes of CYP2A6, CYP2B6, CYP2C8, and CYP2E1 were observed among ethnic populations.
24706167 one intronic SNP in ABCG1 (rs492338) surpassed the exploratory significance threshold for an association with paclitaxel-induced neuropathy in the Caucasian cohort (p = 0.0008) but not in the non-Caucasian replication group
24623479 The sudy investigates the impact of OATP1B1 and CYP2C8 genotype and source of in vitro data on the prediction of drug-drug interaction risk for repaglinide.
24458713 Based on overexpression of human CYP2C8 in mice, CYP2C8 appears to be part of a novel lipid metabolic pathway influencing retinal neovascularization.
24430292 These data are compatible with a higher CYP2C8, CYP2C9, and CYP2C19 activity in Mestizo Ecuadorians as opposed to Spaniards, which could imply differences in dosage requirements for drugs metabolized by these cytochromes
24288737 Significant correlations with chemotherapy resistance were observed for CYP2C8*3 and CYP2C9*2 polymorphisms in patients with chronic lymphoproliferative diseases.
24088129 And those of the genes CYP2C8, CYP3A5 and DPYD associated with toxicity.
23426382 We showed that CYP2C8*3 was associated with lower plasma levels of rosiglitazone and hence a reduced therapeutic response but also a lower risk of developing oedema during treatment with rosiglitazone.
23413280 The increased risk of paclitaxel-induced neuropathy in patients who carry the CYP2C8*3 variant is replicated in African Americans and whites.
23336573 The study described polymorphisms of CYP2C8 in Chinese minorities for the first time, showing significant ethnic differences in the distribution of CYP2C8 among the Han, the Uighur, Hui, and Mongolian Chinese populations.
23307233 Report impact of CYP2C8 polymorphisms on rosiglitazone pharmacokinetics and drug interactions.
23171856 The results indicated that AA and AG genotypes of CYP2C8 (rs1934951) might be predictors for multiple myeloma patients at high risk to develop bisphosphonate-related oxteonecrosis of the jaw.
23118231 The substrate-binding cavity of P450 2C8 is much larger than that of P450 2C19 and P450 2C9.
22723340 The translation efficiency (protein/mRNA ratio) for CYP2C8 was inversely correlated with the expression of miR-103 and miR-107.
22625877 CYP2C8*3 is associated with decreased pioglitazone plasma exposure in vivo and significantly influences the pharmacokinetic magnitude of the gemfibrozil-pioglitazone drug-drug interaction
22527101 CYP2C8 rs11572080, 416G-A and rs10509681, 1196A-G carriers are more likely to achieve complete clinical response to neoadjuvant paclitaxel in the treatment of breast cancer.
22491019 These results have important implications for pharmacogenomic association studies involving the CYP2C locus and are clinically relevant when administering CYP2C-substrate medications.
22339777 significant positive correlation between CYP2C8 rs 1934951 polymorphism and localization of ONJ. Applying PCA to clinical and biochemical factors sharply separates different variables significantly related to pathological process
22313047 Allele frequencies of functionally important CYP2C8 variants in the Czech population are similar to that of other Caucasian populations.
22242967 Co-administration of febuxostat had no effect on rosiglitazone or N-desmethylrosiglitazone pharmacokinetics, suggesting that febuxostat can be given safely with drugs metabolized through CYP2C8.
22028915 monocytes and macrophages express the epoxygenases CYP2J2 and CYP2C8
22028317 Data suggest that sipoglitazar is metabolized first by UGT to form an unstable acyl glucuronide, and this acyl glucuronide is then deethylated by CYP2C8.
22027337 HRM analysis is a fast, reliable, accurate and cost-effective screening method for gene mutations, even very similar cDNA sequences with 83% identities, compared with CYP2C8 and CYP2C9
21977947 CYP2C-poor metabolizers (two defective alleles) are rare (<1%) or absent in Guarani in Brazil, whereas intermediate metabolizers (one defective allele) of CYP2C19, CYP2C9 and CYP2C8 substrates account for 11%, 5.5% and 0.6%, respectively, of the cohort
21838784 CYP2C8 is the dominant enzyme in the biotransformation of montelukast in humans, accounting for about 80% of its metabolism. CYP3A4 only mediates the formation of the minor metabolite M5a/b, and is not important in the elimination of montelukast.
21798861 These results suggest that there is no notable influence of sequence variation in the CYP2C genes on longevity in the examined German population
21791871 The putative binding site of diosmetin coincided with the CYP2C8 substrate binding site.
21778352 The gemfibrozil-repaglinide interaction could be mainly explained by gemfibrozil 1-O-beta-glucuronide concentration-dependent, mechanism-based inhibition of CYP2C8.
21702053 Report impact of CYP2C8-HapC allele on paclitaxel/carboplatin-induced myelosuppression in patients with ovarian cancer.
21697548 Increased reactive oxygen species and enhanced dihydroxyoctadecenoic acid synthesis by endothelial CYP2C8 impair functional recovery and mask the effects of increased epoxyeicosatrienoic acids after ischemic-reperfusion injury.
21697463 In vitro phenotyping indicated that montelukast is an appropriate probe for CYP2C8 inhibition studies.
21685474 No differences in the cumulative risk of developing osteonecrosis of the jaw between patients homozygous and heterozygous for the major allele of the CYP2C8 gene polymorphism.
21375401 Haplotype structures of common variants of CYP2C8,genes in a South Indian population
21270106 CYP2C8*3 does not seem to play an important role in the pharmacokinetics and pharmacodynamics of repaglinide given in a therapeutic dose.
21245287 first report to characterize the allele frequency and haplotype distribution of CYP2C8 in a Korean population, and it provides functional analysis of a new variant CYP2C8*11
21214863 The genetic polymorphism of the CYP2C8*14 allele caused reduced N-deethylation of amiodarone.
21173785 Report impact of population diversity on the distribution of CYP2C8 polymorphisms among Brazilians.
21059750 These data demonstrate that potentiation of the CYP epoxygenase pathway by either increased endothelial EET biosynthesis or globally decreased EET hydrolysis attenuates NF-kappaB-dependent vascular inflammatory responses in vivo.
21054465 A higher frequency of the C35322T SNP was observed among hypertensive patients than control subjects. This potentially important observation requires confirmation and the clinical significance assessed.
21054465 Observational study of gene-disease association. (HuGE Navigator)
21047199 No association is found between CYP2C8 polymorphisms and risk for coronary artery disease and myocardial infarction.
21047199 Observational study of gene-disease association. (HuGE Navigator)
20970553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20890775 discusses linkage disequilibrium between the CYP2C19*17 and CYP2C8*2 alleles in populations of African descent
20857895 In this pilot investigation, we found an increased prevalence of the CYP2C8*4 mutation in the Type 2 diabetic patient group.
20857895 Observational study of gene-disease association. (HuGE Navigator)
20848147 Two important nonsubstrate recognition site residues of CYP2C8 are closely related to heme binding and/or substrate binding. This discovery could explain clinically individual differences in the metabolism of antineoplastic drugs.
20808793 CYP2C polymorphism was not associated with patent ductus arteriosus response to ibuprofen
20808793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20665013 CYP2C19*17 is a frequent genetic variant in Nordic populations that exists in strong linkage disequilibrium with wildtype CYP2C8*1 and CYP2C9*1 alleles, which makes it a determinant for a haplotype exhibiting an efficient CYP2C substrate metabolism
20665013 Observational study of genotype prevalence. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20602612 Observational study of gene-disease association. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20523106 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20436375 Single nucleotide polymorphism rs1058932C>T within the CYP2C8 gene is associated with an increased risk of myocardial infarction, which is, possibly because of a vascular effect of sex steroids, highest in males.
20436375 Observational study of gene-disease association. (HuGE Navigator)
20389299 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20375710 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20368717 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20214592 Review human CYP2C8 structure, substrate specificity, inhibitor selectivity, inducers and polymorphisms.
20212519 CYP2C8 haplotype C and CYP3A5*3 are associated with lower risk of paclitaxel-related neurotoxicity
20212519 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20190184 Observational study of gene-disease association. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20136364 Observational study of genetic testing. (HuGE Navigator)
20031551 Observational study of gene-disease association. (HuGE Navigator)
20013305 Residue 476 was involved in contact with substrate and was important for maintaining the thermal stability of CYP2C8.
19954515 Allele frequency distributions for CYP2C8 among the Ghanaian population are comparable to other African ethnic groups but significantly differ from Caucasian and Asian populations
19954515 Observational study of genotype prevalence. (HuGE Navigator)
19935798 Frequencies of CYP2C8/9 polymorphisms in breast cancer patients were similar to healthy European populations.
19935798 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19833260 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19773535 Studied the recovery of CYP2C8 activity after discontinuation of gemfibrozil treatment using repaglinide as a probe drug, to estimate the in vivo turnover half-life of CYP2C8.
19761371 CYP2C8 clinical pharmacogenetic data are provided by drug class, followed by a discussion of the future of CYP2C8 clinical pharmacogenetic research--REVIEW
19706858 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19504558 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19480553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19470925 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19460752 Knockdown of cytochrome P450, family 2, subfamily C, polypeptide 8 (CYP2C8) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19415824 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19381162 Observational study of genotype prevalence. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19143748 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19129086 Polymorphisms in the CYP2C8 drug-metabolising enzyme gene, but not the SLCO1B1 drug transporter gene, significantly influence rosiglitazone disposition in humans.
19129086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18992346 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18779360 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18769365 This study examined the association between calcineurin inhibitors-induced nephrotoxicity in liver transplant patients and CYP2C8 and CYP2J2 polymorphisms.
18769365 Observational study of gene-disease association. (HuGE Navigator)
18694831 Metabolism of racemic, S-ibuprofen and R-ibuprofen in CYP2C9*3; an increased R-ibuprofen metabolism in CYP2C8*3; and fewer adverse events in CYP2C8*3 volunteers are suggested
18594024 Individuals homozygous for the T allele had an increased likelihood of developing osteonecrosis of the jaw (odds ratio 12.75, 95% confidence interval 3.7-43.5).
18594024 Observational study of gene-disease association. (HuGE Navigator)
18574320 The presence of isoleucine at position 264 in CYP2C8 was found to be important for proper haem insertion and protein folding.
18548238 Relationship between CYP2C8 genotypes and diclofenac 5-hydroxylation in healthy Spanish volunteers is reported.
18548238 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18496133 no association between variation in CYP2C8 or CYP2C9 and myocardial infarction or stroke
18496133 Observational study of gene-disease association. (HuGE Navigator)
18413310 analysis of cytochrome P450 2C8 substrate binding to montelukast, troglitazone, felodipine, and 9-cis-retinoic acid
18303964 genetic variation in CYP2C8 moderately modulates 8,9-, 11,12-, and 14,15-epoxyeicosatrienic acid (EET) formation as reflected in urinary dihydroxyeicosatrienoic acid ezcretion.
18303964 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18216720 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
17925548 Observational study of gene-disease association. (HuGE Navigator)
17923851 Two novel common CYP2C8 haplotypes are identified that significantly associate with altered rate of CYP2C8-dependent drug metabolism in Caucasians in vitro and in vivo.
17923851 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17913794 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17701008 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17670841 The CYP2C8 enzyme is responsible for the reaction leading to O-demethylated silybin.
17635176 Observational study of genotype prevalence. (HuGE Navigator)
17627038 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17627038 These results suggest that alterations in CYP2C8 and CYP2C9 at the CYP2C gene locus are associated with the risk for essential tremor.
17558302 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17558302 *IG group haplotypes might be associated with reduced CYP2C8 activity, possibly through its reduced protein levels.
17429317 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17429317 cigarette smoking may modify the relationship between the I264M and K399R polymorphisms in CYP2C8 and coronary heart disease risk in Caucasians
17373732 Differences exist in protein levels of certain CYPs in non-malignant esophageal tissue (e.g. CYP2C8, CYP3A4, CYP3A5, and CYP2E1) between SCC patients and healthy subjects and may contribute to the development of squamous-cell carcinoma in the esophagus.
17241877 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17241877 Allelic variants of UGT2B7, CYP2C8, and ABCC2, which may predispose to the formation and accumulation of reactive diclofenac metabolites are associated with diclofenac hepatotoxicity
17224914 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17178266 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17175891 Observational study of genetic testing. (HuGE Navigator)
17175891 The polymorphism of the CYP2C8 gene among an African population showed the expected distribution/
17048007 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16957870 comprehensive analysis of the distribution of sEH, CYP2C8, 2C9 and 2J2 in human neoplastic tissues using tissue micro-arrays
16856883 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16646575 The findings summarized in this review suggest that among individuals with Asian or European ancestry, intraethnic differences in the risk of developing adverse effects with drugs that are CYP2C8 or CYP2C9 substrates are to be expected.
16538176 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16475901 Observational study of genotype prevalence. (HuGE Navigator)
16475901 Polymorphism in the CYP2C8 gene in Portugese was studied.
16390351 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
16372821 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16359408 Observational study of genotype prevalence. (HuGE Navigator)
16299241 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16253141 In sigmoid colon, protein levels of CYP2C8 are significantly higher by ~73% than in the descending colon.
16202848 Observational study of gene-disease association. (HuGE Navigator)
16202848 CYP2C8*3 alleles were in strong linkage disequilibrium in both the hypertensive and healthy African American group.
16164496 Observational study of genotype prevalence. (HuGE Navigator)
16141797 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16025294 Observational study of genotype prevalence. (HuGE Navigator)
15961978 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15933212 transcriptional regulation is controlled by constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha
15901749 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15864120 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15864120 there is an association between CYP2J2*7 (but not CYP2C8*3) genotype and hypertension in Caucasian males and Caucasians without a family history of hypertension
15785959 Observational study of genotype prevalence. (HuGE Navigator)
15716363 CYP2C8 single nucleotide polymorphisms could influence the metabolism of CYP2C8 substrates
15606441 Observational study of genotype prevalence, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15469873 Observational study of genetic testing. (HuGE Navigator)
15289789 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15074466 Observational study of genetic testing. (HuGE Navigator)
14676196 a novel peripheral binding site in P450s that may contribute to drug-drug interactions in P450 metabolism
14646690 Observational study of gene-disease association. (HuGE Navigator)
14534525 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12756196 Observational study of genotype prevalence. (HuGE Navigator)
12435384 Observational study of genotype prevalence. (HuGE Navigator)
12435384 the frequency of polymorphisms was analyzed and the number of subjects carrying both of the CYP2C8*1*3 and CYP2C9*1*2 was found to be 4.5-fold higher than expected
11668219 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFG      1 - 70
MNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRS     71 - 140
IEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNS    141 - 210
PWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKS    211 - 280
EFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDA    281 - 350
VVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK    351 - 420
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV    421 - 490
//

Text Mined References (197)

PMID Year Title
26507668 2015 Interethnic differences of cytochrome P450 gene polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26489615 2015 CYP2C8-derived epoxyeicosatrienoic acids decrease oxidative stress-induced endothelial apoptosis in development of atherosclerosis: Role of Nrf2 activation.
26427316 2015 Functional characterization of 12 allelic variants of CYP2C8 by assessment of paclitaxel 6?-hydroxylation and amodiaquine N-deethylation.
26404779 2015 Gender-Specific Effect of CYP2C8*3 on the Risk of Essential Hypertension in Bulgarian Patients.
26252103 2015 [Association of single nucleotide polymorphisms of cytochrome P450 gene with susceptibility to gout in ethnic Han males from coastal regions of Shandong province].
26161459 2016 Impact of CYP2C8*3 polymorphism on in vitro metabolism of imatinib to N-desmethyl imatinib.
26122864 2015 Effect of gender and CYP2C9 and CYP2C8 polymorphisms on the pharmacokinetics of ibuprofen enantiomers.
26115084 2015 Role of cytochrome P450 2C8*3 (CYP2C8*3) in paclitaxel metabolism and paclitaxel-induced neurotoxicity.
25947240 2015 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke in Chinese Populations.
25839935 2015 CYP2C8 rs17110453 and EPHX2 rs751141 two-locus interaction increases susceptibility to ischemic stroke.
25560582 2015 Association of CYP2C8, CYP2C9 and CYP2J2 gene polymorphisms with myocardial infarction in South Indian population.
25406731 2014 Elevated 14,15- epoxyeicosatrienoic acid by increasing of cytochrome P450 2C8, 2C9 and 2J2 and decreasing of soluble epoxide hydrolase associated with aggressiveness of human breast cancer.
25388680 2015 Genetic markers in the EET metabolic pathway are associated with outcomes in patients with aneurysmal subarachnoid hemorrhage.
25160618 2014 Targeting of splice variants of human cytochrome P450 2C8 (CYP2C8) to mitochondria and their role in arachidonic acid metabolism and respiratory dysfunction.
25017038 2014 A potential therapeutic effect of CYP2C8 overexpression on anti-TNF-? activity.
24988984 2015 Direct sequencing and comprehensive screening of genetic polymorphisms on CYP2 family genes (CYP2A6, CYP2B6, CYP2C8, and CYP2E1) in five ethnic populations.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24706167 2014 Genetic heterogeneity beyond CYP2C8*3 does not explain differential sensitivity to paclitaxel-induced neuropathy.
24623479 2014 Reduced physiologically-based pharmacokinetic model of repaglinide: impact of OATP1B1 and CYP2C8 genotype and source of in vitro data on the prediction of drug-drug interaction risk.
24458713 2014 Cytochrome P450 2C8 ?3-long-chain polyunsaturated fatty acid metabolites increase mouse retinal pathologic neovascularization--brief report.
24430292 2014 Genetic polymorphisms of CYP2C8, CYP2C9 and CYP2C19 in Ecuadorian Mestizo and Spaniard populations: a comparative study.
24288737 2013 Role of xenobiotic metabolism enzyme gene polymorphism in the formation of chemotherapy resistance in patients with chronic lymphoproliferative diseases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24088129 2013 Comparative study of polymorphism frequencies of the CYP2D6, CYP3A5, CYP2C8 and IL-10 genes in Mexican and Spanish women with breast cancer.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23755828 2013 Genetic variants associated with warfarin dose in African-American individuals: a genome-wide association study.
23426382 2013 The role of genetic variants in CYP2C8, LPIN1, PPARGC1A and PPAR? on the trough steady-state plasma concentrations of rosiglitazone and on glycosylated haemoglobin A1c in type 2 diabetes.
23413280 2013 CYP2C8*3 increases risk of neuropathy in breast cancer patients treated with paclitaxel.
23336573 2013 CYP2C8 polymorphism frequencies among Han, Uighur, Hui, and Mongolian Chinese populations.
23307233 2013 Application of in vitro-in vivo extrapolation (IVIVE) and physiologically based pharmacokinetic (PBPK) modelling to investigate the impact of the CYP2C8 polymorphism on rosiglitazone exposure.
23171856 2013 Association between CYP2C8 (rs1934951) polymorphism and bisphosphonate-related osteonecrosis of the jaws in patients on bisphosphonate therapy: a meta-analysis.
23118231 2012 Structural characterization of human cytochrome P450 2C19: active site differences between P450s 2C8, 2C9, and 2C19.
22723340 2012 Human CYP2C8 is post-transcriptionally regulated by microRNAs 103 and 107 in human liver.
22625877 2013 Impact of the CYP2C8 *3 polymorphism on the drug-drug interaction between gemfibrozil and pioglitazone.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22527101 2012 CYP2C8*3 predicts benefit/risk profile in breast cancer patients receiving neoadjuvant paclitaxel.
22491019 2013 Multi-ethnic distribution of clinically relevant CYP2C genotypes and haplotypes.
22339777 2012 New approach to analyze genetic and clinical data in bisphosphonate-induced osteonecrosis of the jaw.
22313047 2012 Genetic polymorphisms of CYP2C8 in the Czech Republic.
22242967 2012 The effects of febuxostat on the pharmacokinetic parameters of rosiglitazone, a CYP2C8 substrate.
22028915 2011 Endogenous epoxygenases are modulators of monocyte/macrophage activity.
22028317 2012 An unusual metabolic pathway of sipoglitazar, a novel antidiabetic agent: cytochrome P450-catalyzed oxidation of sipoglitazar acyl glucuronide.
22027337 2012 Rapid identification of CYP2C8 polymorphisms by high resolution melting analysis.
21977947 2012 Distribution of CYP2C polymorphisms in an Amerindian population of Brazil.
21838784 2012 CYP2C8 but not CYP3A4 is important in the pharmacokinetics of montelukast.
21798861 2011 Genetic variation in the CYP2C monooxygenase enzyme subfamily shows no association with longevity in a German population.
21791871 2011 Inhibition of cytochrome P450 2C8-mediated drug metabolism by the flavonoid diosmetin.
21778352 2011 Dose-dependent interaction between gemfibrozil and repaglinide in humans: strong inhibition of CYP2C8 with subtherapeutic gemfibrozil doses.
21702053 2011 Impact of CYP3A5*3 and CYP2C8-HapC on paclitaxel/carboplatin-induced myelosuppression in patients with ovarian cancer.
21697548 2011 Endothelial expression of human cytochrome P450 epoxygenase CYP2C8 increases susceptibility to ischemia-reperfusion injury in isolated mouse heart.
21697463 2011 Evaluation of CYP2C8 inhibition in vitro: utility of montelukast as a selective CYP2C8 probe substrate.
21685474 2011 CYP2C8 gene polymorphism and bisphosphonate-related osteonecrosis of the jaw in patients with multiple myeloma.
21375401 2011 Haplotype structures of common variants of CYP2C8, CYP2C9, and ADRB1 genes in a South Indian population.
21270106 2011 Effect of the CYP2C8 genotype on the pharmacokinetics and pharmacodynamics of repaglinide.
21245287 2011 Discovery of a novel allelic variant of CYP2C8, CYP2C8*11, in Asian populations and its clinical effect on the rosiglitazone disposition in vivo.
21214863 2011 Influence of CYP2C8*13 and CYP2C8*14 alleles on amiodarone N-deethylation.
21173785 2012 Global pharmacogenomics: Impact of population diversity on the distribution of polymorphisms in the CYP2C cluster among Brazilians.
21059750 2011 Endothelial CYP epoxygenase overexpression and soluble epoxide hydrolase disruption attenuate acute vascular inflammatory responses in mice.
21054465 2010 Mutational analysis of CYP2C8 in hypertensive patients using denaturing high performance liquid chromatography.
21047199 2010 Impact of CYP2C8 and 2C9 polymorphisms on coronary artery disease and myocardial infarction in the LURIC cohort.
20970553 2010 Toward personalized medicine in renal transplantation.
20890775 2011 Linkage disequilibrium between the CYP2C19*17 and CYP2C8*2 alleles in populations of African descent.
20857895 2010 Prevalence of CYP450 gene variations in patients with type 2 diabetes.
20848147 2011 Structural and functional insights into polymorphic enzymes of cytochrome P450 2C8.
20808793 2010 Are cytochrome P450 CYP2C8 and CYP2C9 polymorphisms associated with ibuprofen response in very preterm infants?
20665013 2010 Linkage disequilibrium between the CYP2C19*17 allele and wildtype CYP2C8 and CYP2C9 alleles: identification of CYP2C haplotypes in healthy Nordic populations.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20602612 2010 Genetic profile of patients with epilepsy on first-line antiepileptic drugs and potential directions for personalized treatment.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20523106 2010 CYP3A4 genetic polymorphism influences repaglinide's pharmacokinetics.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20436375 2010 Genetic variance in CYP2C8 and increased risk of myocardial infarction.
20389299 2010 Pazopanib-induced hyperbilirubinemia is associated with Gilbert's syndrome UGT1A1 polymorphism.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20375710 2010 Polymorphisms in xenobiotic metabolizing enzymes and diet influence colorectal adenoma risk.
20368717 2011 Impact of CYP2C8*3 on paclitaxel clearance: a population pharmacokinetic and pharmacogenomic study in 93 patients with ovarian cancer.
20214592 2009 Human CYP2C8: structure, substrate specificity, inhibitor selectivity, inducers and polymorphisms.
20212519 2011 Polymorphisms in cytochromes P450 2C8 and 3A5 are associated with paclitaxel neurotoxicity.
20190184 2010 Human liver expression of CYP2C8: gender, age, and genotype effects.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20136364 2010 Errors and reproducibility of DNA array-based detection of allelic variants in ADME genes: PHARMAchip.
20031551 2008 Pharmacogenetic predictors of statin-mediated low-density lipoprotein cholesterol reduction and dose response.
20013305 2010 The role of Ile476 in the structural stability and substrate binding of human cytochrome P450 2C8.
19954515 2009 Characterisation of CYP2C8, CYP2C9 and CYP2C19 polymorphisms in a Ghanaian population.
19935798 2009 CYP2C8 and CYP2C9 polymorphisms in relation to tumour characteristics and early breast cancer related events among 652 breast cancer patients.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19833260 2009 The SLCO1B1*5 genetic variant is associated with statin-induced side effects.
19773535 2009 CYP2C8 activity recovers within 96 hours after gemfibrozil dosing: estimation of CYP2C8 half-life using repaglinide as an in vivo probe.
19761371 2009 Cytochrome P450 2C8 pharmacogenetics: a review of clinical studies.
19706858 2009 Association of cytochrome P450 2C19 genotype with the antiplatelet effect and clinical efficacy of clopidogrel therapy.
19651758 2009 Hepatic cytochrome P450 enzyme alterations in humans with progressive stages of nonalcoholic fatty liver disease.
19504558 2009 Gene single nucleotide polymorphism accumulation improves survival in advanced head and neck cancer patients treated with weekly paclitaxel.
19480553 2009 Pharmacokinetic studies of enantiomers of ibuprofen and its chiral metabolites in humans with different variants of genes coding CYP2C8 and CYP2C9 isoenzymes.
19470925 2009 Japanese-US common-arm analysis of paclitaxel plus carboplatin in advanced non-small-cell lung cancer: a model for assessing population-related pharmacogenomics.
19415824 2009 Non-response to antiepileptic pharmacotherapy is associated with the ABCC2 -24C>T polymorphism in young and adult patients with epilepsy.
19381162 2009 Global variation in CYP2C8-CYP2C9 functional haplotypes.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
19143748 2009 Pharmacogenetic studies of Paclitaxel in the treatment of ovarian cancer.
19129086 2008 Influence of SLCO1B1 and CYP2C8 gene polymorphisms on rosiglitazone pharmacokinetics in healthy volunteers.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18992346 2009 Pharmacogenetic relevance of the CYP2C9*3 allele in a tenoxicam bioequivalence study performed on Spaniards.
18779360 2008 Effect of concomitant artesunate administration and cytochrome P4502C8 polymorphisms on the pharmacokinetics of amodiaquine in Ghanaian children with uncomplicated malaria.
18769365 2008 Role of cytochrome P450 2C8 and 2J2 genotypes in calcineurin inhibitor-induced chronic kidney disease.
18694831 2008 Influence of CYP2C8 and CYP2C9 polymorphisms on pharmacokinetic and pharmacodynamic parameters of racemic and enantiomeric forms of ibuprofen in healthy volunteers.
18619574 2008 The relative contribution of human cytochrome P450 isoforms to the four caffeine oxidation pathways: an in vitro comparative study with cDNA-expressed P450s including CYP2C isoforms.
18594024 2008 Bisphosphonate-related osteonecrosis of the jaw is associated with polymorphisms of the cytochrome P450 CYP2C8 in multiple myeloma: a genome-wide single nucleotide polymorphism analysis.
18574320 2008 Functional role of Ile264 in CYP2C8: mutations affect haem incorporation and catalytic activity.
18548238 2008 Relationship between CYP2C8 genotypes and diclofenac 5-hydroxylation in healthy Spanish volunteers.
18496133 2008 Common variation in cytochrome P450 epoxygenase genes and the risk of incident nonfatal myocardial infarction and ischemic stroke.
18413310 2008 Determinants of cytochrome P450 2C8 substrate binding: structures of complexes with montelukast, troglitazone, felodipine, and 9-cis-retinoic acid.
18303964 2008 Impact of genetic polymorphisms in CYP2C8 and rosiglitazone intake on the urinary excretion of dihydroxyeicosatrienoic acids.
18216720 2008 Interaction of CYP2C8 and CYP2C9 genotypes modifies the risk for nonsteroidal anti-inflammatory drugs-related acute gastrointestinal bleeding.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17925548 2007 Pharmacogenetic assessment of toxicity and outcome after platinum plus taxane chemotherapy in ovarian cancer: the Scottish Randomised Trial in Ovarian Cancer.
17923851 2008 Characterization of novel CYP2C8 haplotypes and their contribution to paclitaxel and repaglinide metabolism.
17913794 2008 Trimethoprim and the CYP2C8*3 allele have opposite effects on the pharmacokinetics of pioglitazone.
17701008 2007 Pharmacokinetics and pharmacodynamics of paclitaxel with carboplatin or gemcitabine, and effects of CYP3A5 and MDR1 polymorphisms in patients with urogenital cancers.
17670841 2007 Silybin is metabolized by cytochrome P450 2C8 in vitro.
17635176 2007 Genetic polymorphism of cytochrome P450s and P-glycoprotein in the Finnish population.
17627038 2007 Changes at the CYP2C locus and disruption of CYP2C8/9 linkage disequilibrium in patients with essential tremor.
17558302 2007 CYP2C8 haplotype structures and their influence on pharmacokinetics of paclitaxel in a Japanese population.
17429317 2007 CYP2J2 and CYP2C8 polymorphisms and coronary heart disease risk: the Atherosclerosis Risk in Communities (ARIC) study.
17373732 2007 Cytochrome P450 levels are altered in patients with esophageal squamous-cell carcinoma.
17241877 2007 Genetic susceptibility to diclofenac-induced hepatotoxicity: contribution of UGT2B7, CYP2C8, and ABCC2 genotypes.
17224914 2007 Pharmacogenetic analysis of paclitaxel transport and metabolism genes in breast cancer.
17178266 2006 Pharmacokinetics and pharmacodynamics of rosiglitazone in relation to CYP2C8 genotype.
17175891 2006 A fast and reliable single-run method for genotyping of the human cytochrome P450 2C8 gene for different ethnic groups.
17048007 2007 Association of warfarin dose with genes involved in its action and metabolism.
16957870 2006 Distribution of soluble epoxide hydrolase, cytochrome P450 2C8, 2C9 and 2J2 in human malignant neoplasms.
16856883 2006 The effects of human CYP2C8 genotype and fluvoxamine on the pharmacokinetics of rosiglitazone in healthy subjects.
16646575 2006 Interethnic and intraethnic variability of CYP2C8 and CYP2C9 polymorphisms in healthy individuals.
16538176 2006 Genetic susceptibility to carbamazepine-induced cutaneous adverse drug reactions.
16475901 2006 CYP2C8 polymorphism among the Portuguese.
16390351 2006 The impact of CYP2C8 polymorphism and grapefruit juice on the pharmacokinetics of repaglinide.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16372821 2005 Effect of genetic polymorphisms in cytochrome p450 (CYP) 2C9 and CYP2C8 on the pharmacokinetics of oral antidiabetic drugs: clinical relevance.
16359408 2005 Short communication: high prevalence of the cytochrome P450 2C8*2 mutation in Northern Ghana.
16299241 2005 Association of CYP2C8, CYP3A4, CYP3A5, and ABCB1 polymorphisms with the pharmacokinetics of paclitaxel.
16253141 2005 Distribution of cytochrome P450 2C, 2E1, 3A4, and 3A5 in human colon mucosa.
16202848 2005 The Prevalence of CYP2C8, 2C9, 2J2, and soluble epoxide hydrolase polymorphisms in African Americans with hypertension.
16164496 2005 Genetic polymorphism of CYP2C8 in three Malaysian ethnics: CYP2C8*2 and CYP2C8*3 are found in Malaysian Indians.
16141797 2005 No evidence that polymorphisms in CYP2C8, CYP2C9, UGT1A6, PPARdelta and PPARgamma act as modifiers of the protective effect of regular NSAID use on the risk of colorectal carcinoma.
16025294 2005 Polymorphism of CYP2D6, CYP2C19, CYP2C9 and CYP2C8 in the Faroese population.
15961978 2005 Polymorphic organic anion transporting polypeptide 1B1 is a major determinant of repaglinide pharmacokinetics.
15933212 2005 Human CYP2C8 is transcriptionally regulated by the nuclear receptors constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha.
15901749 2005 Pharmacokinetics of paclitaxel in ovarian cancer patients and genetic polymorphisms of CYP2C8, CYP3A4, and MDR1.
15864120 2005 Single nucleotide polymorphisms in the CYP2J2 and CYP2C8 genes and the risk of hypertension.
15785959 2005 CYP2C8 polymorphism frequencies among malaria patients in Zanzibar.
15716363 2005 Functional characterization of five novel CYP2C8 variants, G171S, R186X, R186G, K247R, and K383N, found in a Japanese population.
15606441 2005 The effect of the cytochrome P450 CYP2C8 polymorphism on the disposition of (R)-ibuprofen enantiomer in healthy subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469873 2004 A simple multiplex PCR method for the concurrent detection of three CYP2C8 variants.
15469410 2004 Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population.
15365880 2004 A frameshift variant of CYP2C8 was identified in a patient who suffered from rhabdomyolysis after administration of cerivastatin.
15289789 2004 Interindividual variability in ibuprofen pharmacokinetics is related to interaction of cytochrome P450 2C8 and 2C9 amino acid polymorphisms.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15074466 2004 Development and evaluation of a rapid and reliable method for cytochrome P450 2C8 genotyping.
15039299 2004 Quantitative contribution of CYP2D6 and CYP3A to oxycodone metabolism in human liver and intestinal microsomes.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676196 2004 Structure of human microsomal cytochrome P450 2C8. Evidence for a peripheral fatty acid binding site.
14646690 2003 Allelic variants of cytochromes P450 2C modify the risk for acute myocardial infarction.
14559847 2003 Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol.
14534525 2003 Polymorphism in CYP2C8 is associated with reduced plasma concentrations of repaglinide.
12936704 2003 Identification of CYP3A4 and CYP2C8 as the major cytochrome P450 s responsible for morphine N-demethylation in human liver microsomes.
12920163 2003 Inhibitory effect of glyburide on human cytochrome p450 isoforms in human liver microsomes.
12756196 2003 Genetic polymorphisms of CYP2C8 in Japanese population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435384 2002 Linkage between the CYP2C8 and CYP2C9 genetic polymorphisms.
12429347 2002 CYP2C8 polymorphisms in Caucasians and their relationship with paclitaxel 6alpha-hydroxylase activity in human liver microsomes.
11668219 2001 Polymorphisms in human CYP2C8 decrease metabolism of the anticancer drug paclitaxel and arachidonic acid.
10874126 2000 Identification of human cytochrome P450 isoforms that contribute to all-trans-retinoic acid 4-hydroxylation.
10768437 2000 Gene expression in distinct regions of the heart.
10704292 2000 The human CYP2C locus: a prototype for intergenic and exon repetition splicing events.
10487415 1999 Gene structure of CYP2C8 and extrahepatic distribution of the human CYP2Cs.
9890157 1998 Molecular genetics of the human cytochrome P450 monooxygenase superfamily.
9842986 Human liver microsomal metabolism of paclitaxel and drug interactions.
9797707 1998 Characterisation of xenobiotic-metabolising enzyme expression in human bronchial mucosa and peripheral lung tissues.
9586955 1998 Regional distribution of individual forms of cytochrome P450 mRNA in normal adult human brain.
8870687 1996 Inter-individual variability in the oxidation of 1,2-dibromoethane: use of heterologously expressed human cytochrome P450 and human liver microsomes.
8530044 1995 A 2.4-megabase physical map spanning the CYP2C gene cluster on chromosome 10q24.
7841444 1994 Fluorescence in situ hybridization analysis of chromosomal localization of three human cytochrome P450 2C genes (CYP2C8, 2C9, and 2C10) at 10q24.1.
7704034 1994 Biochemistry and molecular biology of the human CYP2C subfamily.
7574697 1995 Molecular cloning, expression and characterization of an endogenous human cytochrome P450 arachidonic acid epoxygenase isoform.
3697070 1987 cDNA and amino acid sequences of two members of the human P450IIC gene subfamily.
3500169 1987 Characterization of multiple human cytochrome P-450 1 cDNAs. The chromosomal localization of the gene and evidence for alternate RNA splicing.
3196692 1988 Characterization of cDNAs, mRNAs, and proteins related to human liver microsomal cytochrome P-450 (S)-mephenytoin 4'-hydroxylase.
2729895 1989 Cloning, expression and chromosomal localization of a member of the human cytochrome P450IIC gene sub-family.
2216732 1990 Sequence of a human liver cytochrome P-450 cDNA clone.
2009263 1991 Cloning and expression of complementary DNAs for multiple members of the human cytochrome P450IIC subfamily.
1707679 1991 Isolation of the human cytochrome P-450 IIC8 gene: multiple glucocorticoid responsive elements in the 5' region.