Property Summary

NCBI Gene PubMed Count 811
PubMed Score 1627.43
PubTator Score 2196.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 4.4e-02

Protein-protein Interaction (2)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
778 screening 20295 / 0 / 75572 CYP2C19 Assay
899 confirmatory 1964 / 1313 / 7043 qHTS Assay for Inhibitors and Substrates of Cytochrome P450 2C19
1025 screening 1 / 0 / 95866 HTS Assay for Activators of Cytochrome P450 2A19
1851 other 0 / 0 / 0 Cytochrome panel assay with activity outcomes

Gene RIF (870)

PMID Text
27348249 Among patients with minor ischemic stroke or transient ischemic attack, the use of clopidogrel plus aspirin compared with aspirin alone reduced the risk of a new stroke only in the subgroup of patients who were not carriers of the CYP2C19 loss-of-function alleles. These findings support a role of CYP2C19 genotype in the efficacy of this treatment.
27239927 CYP2C19 gene polymorphisms associated with different responses to antiplatelet therapy in patients with coronary artery disease.
27166533 AUC of omeprazole was higher in females while its elimination also took longer compared with males. AUC of omeprazole was significantly higher in Homz PMs indicating that CYP2C19* displayed genetically deficient metabolism in its homozygous state.
27010145 The genotypic polymorphism is effective on the rate of eradication. Eradication treatment rate with rabeprazole is influenced by CYP2C19 genotype.
26970786 Increased CYP2C19 activity could slightly ameliorate mineralocorticoid deficiency in 21-hydroxylase Deficiency.
26916483 CYP2C19 metabolizer status is not associated with the composite outcome of cardiovascular death, MI, or stroke in medically managed ACS patients treated with clopidogrel or prasugrel.
26822491 no evidence was found that CYP2C19 polymorphisms are associated with susceptibility to primary open-angle glaucoma.
26817099 High frequency of CYP2C19 ultrarapid metabolizers in Russian patients with peptic ulcer may be associated with insufficient response to proton pump inhibitors.
26722519 Our results shed new light on CYP2C19 polymorphisms in Li individuals
26690534 In the title.
26663068 Data show that the cytochrome P-450 CYP2C19 *2 allele is an independent risk factor for recurrent stroke.
26639454 Changing prescribing practice due to CYP2C19 drug-drug interaction or genotype is unlikely to be useful in most US ED populations.
26456622 Observation in Chinese patients with systemic lupus erythematosis indicated that the combination genetic marker of CYP2C19*2 and CYP2B6 -750 T > C genotypes was associated with 4-OH-CPA plasma concentration, short term efficacy and adverse reactions of cyclophosphamide.
26343256 The mean plasma concentrations and the mean dose-corrected (C/D) plasma levels of DCIT were significantly higher in patients with the CYP2C19*1/*1 genotype.
26338921 Individuals with CYP2C19*17 may have increased risk of ischemic events following endovascular treatment, independent of clopidogrel responsiveness.
26313485 CYP2C19 ultrarapid metabolizers were associated with reduced tolerance to a fixed titration schedule of open-label escitalopram in this autism spectrum disorder study sample.
26298540 Results suggest that CYP2D6 and CYP2C19 genotyping alone probably do not improve the prediction of treatment resistance in schizophrenia
26296572 These results demonstrated the suppressing role of hsa-miR-29a-3p on CYP2C19 expression.
26272232 In this article experts discuss the current state, challenges, and future direction of CYP2C19 pharmacogenetic testing for clopidogrel therapy.
26265611 Genetic CYP2C19 polymorphisms are relative to the inferior, the antiplatelet activity after clopidogrel admission and may increase the incidence of ischemic events in patients with ACS.
26264906 a significant association was found between CYP2C19*2 and PLA1/A2 in clopidogrel semi-responders.
26244421 The need for a more comprehensive CYP2C19 genotyping approach.
26239729 In a retrospective study of 17 critically ill patients treated for invasive aspergillosis with voriconazole it was found that the metabolizing capacity of CYP2C19 depended on the genotype.
26223287 This is the first report to show a relationship between the CYP2C19 polymorphism and valproic acid-induced weight gain in female patients with epilepsy.
26218263 CYP2C19 genetic polymorphisms were associated with response to therapy in patients with acute coronary syndrome undergoing percutaneous coronary intervention.
26153442 findings greatly enrich the knowledge of biological effects of these newly found CYP2C19 mutations and aid the application of this knowledge to future individualized drug therapy in clinic.
26147597 The CYP 2C19 681 G>A clopidogrel resistance mutation was studied in PCI patients with acute coronary syndrome. The GG genotype had less clopidogrel resistance, recurrent angina, acute myocardial infarction, and intra-stent thrombosis than GA or AA.
26126958 Data suggest that primary cytochrome P450 in liver microsomes catalyzing 9-hydroxylation of (-)-cis- and (-)-trans-rose oxide is CYP2B6 (and CYP2C19 to some extent); rose oxide is aroma compound from essential oils and is used in food and perfume.
26117917 The cardiovascular events significantly morefrequently occurred during 12 and 18 months in resistant diabetics and in the patients with an allele lacking the *2/*3 CYP2C9 gene function and AT/TT polymorphism of the thromboxane synthase gene TBS1.
26062298 Instead of using a standard dosage regimen for all patients, the voriconazole dosage regimen needs to be optimized for patients with different CYP2C19 genotypes
26021325 The phylogenetic tree of the CYP2C19 haplotypes revealed rs12769205 arose first on CYP2C19*35 and that rs4244285 was added later, creating CYP2C19*2
25999694 CYP2C19 genotype affected not only the pharmacokinetics of voriconazole, but its intrasubject variability
25995169 Three covariates, age, albumin concentration, and CYP2C19 genotype, were identified to significantly affect icotinib pharmacokinetic profiles in healthy subjects.
25993709 findings indicated that carrying a CYP2C19*2 allele with a functional CYP2C19*1 allele had no significant association with in-stent restenosis 1 year after percutaneous coronary intervention
25953735 CYP2C19 *1/*2 subjects had higher AUCt.
25946232 Platelet reactivity is higher in patients with heterozygous and homozygous carriers of CYP2C19*2 versus common genotype and may predict an increased risk of clopidogrel response variability and/or experiencing adverse cardiac events
25927305 CYP2C19*2 polymorphism plays an important role in the development of esophageal squamous cell carcinoma
25921128 CYP2C19 genotype IM was the most common genotype in Thai patients with chronic hepatitis B. Genotype RM could be an associated factor for aggressive presentation in hepatocellular carcinoma related to chronic hepatitis B.
25897911 CYP2C19 allele could affect the underlying cardiovascular risk with clopidogrel treatment in patients with acute coronary syndrome.
25877345 CYP2C19 polymorphism affects the efficacy of clopidogrel differently among Westerners and Asians (Meta-Analysis)
25846871 Genetic variation in the CYP2C19 gene in a healthy Mexican population.
25845826 genetic association/pharmacogenetics studies: Data suggest that genetic variation in CYP2C19 is related to metabolic clearance/bioavailability of S-mephenytoin, an anticonvulsant agent.
25844821 Metabolizer phenotypes were based on CYP2C19 haplotypes.Children with the poor metabolizers phenotype developed worse Asthma control after 6 months of lansoprazole treatment for poorly controlled asthma.
25838219 In conclusions, acute coronary syndrome, CYP2C19 PM, and high platelet reactivity were associated with the occurrence of Intraprocedural thrombotic event, and Intraprocedural thrombotic event was a predictor of cardiovascular events after discharge
25823779 These findings suggest that using CYP2C19 genotype to guide P2Y12 inhibitor selection is feasible.
25803758 This study demonstrated that Clinical evaluation of analgesic ineffectiveness and adverse effects led to the high likelihood of identifying patients with CYP2D6, CYP2C19, and CYP2C9 alleles associated with alterations in analgesic metabolism.
25730082 coexisting polymorphisms of CYP3A5*3 and 2C19*2, but not P2Y12*1, play an important role in the variability of clopidogrel's curative effect
25712182 CYP2C19*2*2 versus *1*1 and *1*2 genotype (OR: 11.625; 95% CI: 3.498-38.633), CYP4F2 AA versus GA and GG genotype (OR: 3.532; 95% CI: 1.153-10.822) were associated with early stent thrombosis.
25686762 The CYP2C19 phenotype was the only single-gene approach to predict health-care outcomes
25652102 CYP2C19 genotypes influenced the clearance of R-warfarin.
25605208 CYP2C19 genetic polymorphism is associated with gastric cancer.
25600201 Kalanchoe crenata extract is a potent inhibitor of CYP2C19 activity.
25552922 Allele frequency of CYP2C19 polymorphisms in the Japanese population
25542807 CYP2C19*2 is a determinant for the formation of the active metabolite of clopidogrel and its antiplatelet effects.
25529343 CYP2C19 genotypes are significantly associated with early lesion recurrence in Korean acute stroke patients treated with clopidogrel.
25518511 Examining the effects of genetic variations in cytochrome P450 isoform CYP2C19 (a clopidogrel metabolizer) revealed the enhanced aggregation stimulated with 20 mumol of ADP in the carriers of slowly clopidogrel-metabolizing haplotype of CYP2C19.
25518510 Evaluation of ADP-induced platelet aggregation in patients with different CYP2C19 gene polymorphisms during the administration of original or generic clopidogrel showed no significant differences in its resistance.
25511576 High-dose clopidogrel could not overcome the variability of clopidogrel antiplatelet effects between the CYP2C19 *2 carriers and non-carriers in patients treated with percutaneous coronary intervention.
25498969 Hydroxylation index of omeprazole in relation to CYP2C19 polymorphism and sex in a healthy Iranian population
25495411 CYP2C19*2 is associated with decreased clearance of omeprazole, rabeprazole and pantoprazole, that could be associated with higher drug efficacy.
25495406 the polymorphic enzymes CYP2C19 and CYP2D6 indeed have endogenous functions in the development and regulation of specific neuronal pathways, translating into inter-individual differences in cognition and risk for depression and suicide.
25466287 Studied CYP2C19 deletion allele and it's association with triple-negative breast cancer; found that inherited changes in CYP2C19 gene participating in estrogen catabolism have an influence on the molecular subtype of breast cancer.
25465810 CYP2C19 loss-of-function polymorphism is associated with a higher incidence of intra-stent thrombi after first-generation DES implantation, while the impact is attenuated following EES implantation.
25463363 The positive impact of smoking on clopidogrel AM generation via CYP1A2 induction might be greater than the opposite effects exerted by CYP2C19*2 genotype.
25428337 The impact of adjunctive Buchang Naoxintong Capsule (NXT) on dual antiplatelet therapy in patients with cytochrome P450 2C19*2 (CYP2C19*2) polymorphism undergoing percutaneous coronary intervention, was determined.
25403437 We observed that CYP2C19 polymorphism is associated with endometrisis in Brazilian women and can be considered a potential biomarker of the disease.
25381554 The aim of this study was to analyze the CYP2C19 genetic polymorphism among Han and Uyghur patients with cardiovascular and cerebrovascular diseases in the Kashi area of Xinjiang.
25339025 CYP2C19 polymorphisms are associated with response to tamoxifen in breast cancer.
25323806 Effect of CYP2C19 polymorphisms on the clinical outcome of low-dose clobazam therapy in Japanese patients with epilepsy
25303292 Genetic variation in the CYP2C19 gene gives rise to poor and extensive metabolizer phenotypes.
25286744 Saint John's wort significantly reduced exposure with ambrisentan irrespective of the CYP2C19 genotype.
25264752 Association between CYP2C19 polymorphisms and the risk of Coronary artery disease was found only in Japanese women without conventional coronary risk factors such as Diabetes , Chronic kidney disease or Dyslipidemia.
25258374 The association between CYP2C19 LoF allele carriage and major cardiovascular outcomes differs based on the ethnic population of the study and, to a lesser extent, the clopidogrel indication.
25245581 The S/R ratios of VEN were significantly influenced by both CYP2D6 and CYP2C19 genotypes.
25241292 CYP2C19 polymorphisms determine the metabolic profile and biotransformation of metamizole.
25207801 No significant association between CYP2C19 gain-of-function (*17, GOF) and clinical events was detected.
25201060 CYP2C19 polymorphism significantly correlates with clinical outcome in non-chronic kidney disease (CKD) patients, and CKD status modifies the association of CYP2C19 polymorphism in predicting clinical outcomes following coronary stent implantation.
25156215 The impact of CYP2C19 loss-of-function gene on clinical outcome is more powerful in early phase of acute coronary syndrome compared with stable angina.
25155930 Coadministration of atazanavir and voriconazole may be feasible in selected HIV-positive patients; therapeutic drug monitoring and CYP2C19 genotyping may optimize exposure of both drugs.
25154506 Impact of cytochrome P450 2C19 polymorphisms on citalopram/escitalopram exposure: a systematic review and meta-analysis
25141895 A different frequency for the CYP2C19 *4B allele.
25121365 No association of 416 C > T and 1061 A > T in CYP2C9 or 681 G > A and 636 G > A in CYP2C19 was observed with response phenotype in genotypic analysis.
25113522 The observed relationship is mediated by the role of CYP2D6 and CYP2C19.
25109411 CYP2C19*2/*3 and MDR1 C3435T polymorphisms are important determinants of lansoprazole pharmacokinetics
25106522 the distribution of the ABCB1, CYP3A5, CYP2C19, and P2RY12 gene polymorphisms distinguishes to the Mexican Mestizos population from other ethnic groups.
25084200 Younger age and the presence of CYP2C19 gain-of-function alleles were associated with subtherapeutic voriconazole concentrations.
25068772 If a patient has had the intermediate metabolizer CYP2C19 genotype and concomitant use of WF and a proton pump inhibitor after open heart surgery, lansoprazole intensifies the effects of WF and is associated with bleeding events.
25030528 Results show the AA genotype and A allele of CYP2C19 G681A may be related to the occurrence and recurrence of cerebral ischemic stroke.
25008027 Prasugrel active metabolite exposure was not influenced by CYP2C19 gene polymorphism in patients with coronary artery disease. In contrast, clopidogrel active metabolite exposure was significantly reduced in patients carrying the loss-of-function allele.
24996381 CYP2C19*2 gene polymorphism may be associated with clopidogrel resistance.
24996380 Comparison of acid inhibition with standard dosages of proton pump inhibitors in relation to CYP2C19 genotype in Japanese
24956251 The findings suggest that CYP2C19 gene dose may serve as a potential indicator for assessing methadone dose and tolerance in MMT patients.
24956245 ). Outpatient screening for CYP2C19 loss-of-function polymorphisms is feasible, and a strategy of clopidogrel dose escalation may improve platelet inhibition in appropriately selected patients.
24952855 The POPular Genetics study is the first large-scale trial comparing CYP2C19 genotype-guided antiplatelet therapy to a nontailored strategy in terms of net clinical benefit, safety, and cost-effectiveness.
24945780 CYP2C19.10 variant partially metabolizes clopidogrel and 2-oxo-clopidogrel, and the presence of CYP2C19*10 allele affects the CY2C19*2 TaqMan genotyping assay and results in misclassification of CYP2C19*10/*2 as CYP2C19*2/*2
24906606 Data sugget that people with patitis viruses but with the homozygous or heterozygous variant genotypes (*2/*2, *2/*3, *3/*3) of cytochrome P450 CYP2C19 may have higher possibilities of getting PLC than with other allelic genotypes (*1/*1, *1/*2, *1/*3).
24877854 Patients carrying CYP2C19 LOF alleles who are treated with clopidogrel may trend toward a poor prognosis after ET.
24858822 Impact of age on serum concentrations of venlafaxine and escitalopram in different CYP2D6 and CYP2C19 genotype subgroups
24821368 The impact of CYP2C19 polymorphism on clinical outcome seems to be more significant in non-DM compared with DM in patients with coronary stents.
24819914 This study demonstrated the effect of CYP2C19 polymorphisms on stiripentol administration in Japanese cases of Dravet syndrome.
24798722 The investigators conducted a retrospective analysis of 1143 individuals with known CYP2D6, CYP2C19 and CYP2C9 genotypes for drug interactions
24796765 Functional variants in CYP2C19 may contribute to endometriosis susceptibility in both familial and sporadic cases.
24782221 The influence of genetic polymorphism of Cyp2c19 isoenzyme on the pharmacokinetics of clopidogrel and its metabolites in patients with cardiovascular diseases
24781308 The present study demonstrated no significant relation between peri-procedural MD and high on-clopidgrel PA associated with CYP2C19 reduced-function allele in patients undergoing elective PCI.
24762860 Bleeding events of clopidogrel-treated patients after acute myocardial infarction were significantly more common among black carriers of CYP2C19*17 or CYP1A2*1C
24761684 High dose omeprazole and high dose amoxicillin was ineffective in eradication of H. pylori in patients with CYP2C19 gene polymorphism.
24723553 6.3-kb alpha2A-AR variant is associated with increased platelet reactivity to epinephrine and has an additive effect along with CYP2C19*2 loss-of-function allele on P2Y12-mediated platelet responses in patients with stable angina on dual antiplatelet therapy
24710841 Effectiveness of clopidogrel dose escalation to normalize active metabolite exposure and antiplatelet effects in CYP2C19 poor metabolizers
24690327 Bifurcation plots suggested conservation of alleles conferring slow metabolism (CYP2C19*2 and *3). relative extended haplotype homozygosity (REHH) was high around CYP2C19*2 in Yoruba (REHH 8.3, at 133.3 kb from the core) and to a lesser extent in Europeans (3.5, at 37.7 kb) and Asians (2.8, at -29.7 kb).
24617511 the PFA P2Y test showed a statistically significant association with CYP2C19 metabolizer phenotypes based on CYP2C19 genotyping and effectively determined the risk groups resistant to clopidogrel therapy, including PM.
24608794 Genetic CYP2C19 polymorphisms and CAD risk factors - type 2 diabetes mellitus and BMI - synergistically affect the antiplatelet activity of clopidogrel and the occurrence of major adverse cardiovascular events after PCI.
24599773 The efficacy of first-line triple therapy for H. pylori infections in the poor and extensive metabolizer genotypes of CYP2C19 is reported.
24589079 CYP2C19 polymorphism determines the efficacy of platelet aggregation inhibitors in acute coronary syndrome Korean patients.
24581091 CYP2C19 polymorphism have clinical implication in the treatment of coronary disease in indian population.
24576527 The allele frequencies for CYP2C19*2 and CYP2C19*17 in this Oglala Sioux population group were 11% (95% CI 7%-16%) and 9% (95% CI 5%-13%), respectively. No subjects carried the CYP2C19*3 allele.
24535487 Results show that CES1A2 A(-816C and the CYP2C19 loss-of-function alleles were associated with attenuated platelet reactivity to clopidogrel.
24527758 believe that the findings are the first results of CYP allele distributions in the Turkish population and provide an understanding of the epidemiological studies that correlate therapeutic approaches and etiology of CRC especially in Turkish patients
24519754 Acquired loss of CYP2C19 activity occurs in a substantial proportion of patients with multiple myeloma.
24510350 The interaction between CYP2C19 (*)3 polymorphism and smoking plays an important role in the mechanism of lung cancer in Chinese population.
24504666 Positive clinical response to clopidogrel is independent of paraoxonase 1 Q192R and CYP2C19 genetic variants
24501942 In all the patients, CYP2C19 genotype was identified as a control rate of PPI metabolism (extensive, intermediate and poor metabolizers).
24492587 Amino acid residue 72 plays a key role in tricyclic antidepressant drug metabolism by limiting the binding affinities of CYP2C19 and CYP2C9.
24488700 This study demonistrated that gene polymorphisms of CYP2C19 did not predict SSRI responses in Chinese Han depressed patients. Neuroendocrine factors also were not significant independent predictors for SSRI responses.
24443221 CYP3A5*3, CYP1A2*1F, CYP3A4*1B, and CYP2C19*2 were the most frequent alleles found in our sample. Significant differences in genotype and allelic distribution between African and European descents were observed for CYP3A4 and CYP3A5 genes
24440142 CYP2C19 genotype is associated with an increased risk of cardiovascular events following stent implantation in Japanese patients.
24430292 These data are compatible with a higher CYP2C8, CYP2C9, and CYP2C19 activity in Mestizo Ecuadorians as opposed to Spaniards, which could imply differences in dosage requirements for drugs metabolized by these cytochromes
24403552 CYP2C19 and 2C9 genotypes were not major determinants of voriconazole metabolism. No toxic serum level of voriconazole or its metabolites could be identified.
24402637 genetic polymorphism determines extent of clopidogrel metabolism in coronary artery disease patients
24346747 Results suggest that the genetic polymorphisms of CYP2C19 significantly affect the pharmacokinetics of atomoxetine.
24345815 results showed that the CYP2C19 and/or P450 oxidoreductase genotypes have an impact on the clearance of clobazam and/or N-desmethylclobazam
24340040 the number of drugs that are metabolized by each CYP, the impact of CYP SNPs, as well as CYP expression patterns in different tissues. The most important polymorphic CYPs were found to be 1A2, 2D6, 2C9 and 2C19.
24338437 Data suggest that CYP2C9, CYP2C19, and CYP2D6 SNPs and haplotypes may affect the response to antiepileptic drugs.
24330577 This study leads to the conclusion that hyperlipidemia and CYP2C19 impotency are possible risk factors for the development of ISR in VAS-treated patients with ischemic.
24315317 According to the study, Iranian population's CYP2C19 allele frequencies completely differ from other Asian ethnicities and matches African and European ethnicities the most.
24279856 Ticagrelor is likely to be cost-effective even for individuals not carrying a CYP2C19 LoF allele
24257813 Amongst patients taking escitalopram (n=223), the genotype CYP2C19 was significantly associated with escitalopram serum concentrations and desmethylescitalopram:escitalopram ratio
24222221 In a Mexican population CYP2C19 is more involved in acenocoumarol metabolism than CYP2C9 and APOE.
24214141 The effect of CYP2C19 genotype on the time course of platelet aggregation inhibition after clopidogrel administration
24169346 Polymorphisms of CYP2C19, the key metabolic enzyme for tivantinib, should be addressed to translate the previous Western study to Asian population, because higher incidence of poor metabolisers (PMs) is reported in Asian population.
24151801 Clinical assessment of CYP2C19 and CYP2D6 metabolizer status is feasible, well accepted and optimizes drug treatment in psychiatry.
24113215 study investigated the association between CYP2C19 polymorphisms and an increased risk of diabetic retinopathy; findings show evidence that CYP2C19 polymorphisms may be an independent risk factor for microvascular disease in females
24089073 These preliminary findings suggest that elderly CYP2D6/CYP2C19 poor metabolizers with a high anticholinergic drug burden are at increased risk of elevated serum anticholinergic activity
24088578 CYP2C19 polymorphism is associated with response to antiplatelet therapy and exhibit diminished platelet inhibition and an increased risk of adverse events.
24088005 Association between polymorphic variant CYP2C19*2 with changes of platelet aggregation after administration of clopidogrel was found.
24080325 Review/Meta-analysis: CYP2C19 polymorphism is significantly associated with risk of adverse clinical events in clopidogrel-treated patients.
24080149 Low PON1 activity is associated with a low response to clopidogrel and a high frequency of intra-stent thrombus only in in CYP2C19 loss-of-function carriers carriers.
24022708 Compared to the CYP2Cl9 EMs, the CYP2C 19 PM group showed slower elimination and betteroral bioavailability of lansoprazole, much higher plasma concentrations of LSZS
24019397 The standpoint of higher frequencies of CYP2C19 LOF alleles, CYP2C19 PM genotype was significantly associated with a higher risk of MACCE compared with CYP2C19 EM/IM genotypes only in patients with AMI but not in patients with stable angina.
24016178 The gene dose of CYP2C19 may potentially serve as an indicator for the plasma R-methadone/methadone dose ratio and cardiac side effect in patients receiving methadone maintenance therapy.
24015291 meta-analysis suggests that the CYP2C19 PMs genotypes most likely contributes to cancer susceptibility, particularly in the Asian populations.
23981380 Patients with coronary heart disease who were carriers of the loss-of-function allele CYP2C19*2 were at increased risk for secondary cardiovascular disease events.
23959307 CYP2J2 and CYP2C19 are the major liver microsomal enzymes responsible for biotransformation of albendazole and fenbendazole to produce active anthelmintics in vivo.
23951298 ESR1 PvuII, CYP2C19*2 and UGT2B15*2 polymorphisms were analyzed in the tamoxifen-treated subgroup of patients.
23941071 These findings indicate that individuals carrying the CYP2C19 rs3814637CC or CYP2C9 rs1057910AA or GGCX rs699664AA genotype needed higher warfarin doses in the Chinese population.
23895809 African American patients undergoing percutaneous coronary intervention not only have a higher prevalence of HTPR to clopidogrel but also have higher CYP2C19*2 allele carrier status compared with whites.
23886632 About three quarters of Japanese patients with acute coronary syndromes carried CYP2C19 variant alleles mouseclick
23877834 Data indicate expression of human CYP2C19 gene in transgenic mice causes developmental alterations in the brain; hypothesize that expression of CYP2C19 prenatally may affect brain development by metabolizing endogenous compounds influencing this development; CYP2C19 polymorphism may have a role in interindividual susceptibility for psychiatric disorders
23874401 Data suggested that the PM phenotype caused by the variation on CYP2C19 gene is associated with increased risk of digestive system cancer, especially in East Asians.
23872648 In acute coronary syndrome patients, CYP2C19 SNP was associated with high on-treatment platelet reactivity and a subsequently increased risk of adverse clinical events at one-year follow-up following DES implantation and clopidogrel administration.
23850318 Personalized antiplatelet therapy according to CYP2C19 genotype following percutaneous coronary intervention decreases incidence of adverse cardiovascular events in a Chinese population.
23850044 The CYP2C19*2 and CYP2C19*17 polymorphisms were genotyped in acute coronary syndrome patients. Only CYP2C19*2 moderately influenced platelet clopidogrel reactivity. Neither influenced outcome.
23834474 Report expanded pharmacokinetic model that can be used to evaluate different dosing scenarios, during pregnancy, of drugs cleared by CYP2C19.
23785064 Inclusion of all four inhibitors predicted an in vivo decrease in CYP2C19 (95%) and CYP3A4 (60-62%) activity.
23754447 CYP2C19 polymorphisms are a risk factor for developing digestive tract cancer. [Meta-analysis]
23736997 Postmenopausal breast cancer patients with a CYP2C19*2 variant allele had a worse prognosis, but derived more benefit from adjuvant tamoxifen treatment.
23700873 CYP2C19 cytochrome has different isoforms responsible for the variation of its catalitic activity, in converting Clopidogrel into active metabolits.
23646118 Carriage of CYP2C19 loss-of-function variants is associated with increased H. pylori eradication rate in patients taking PPI-based triple therapies when omeprazole or lansoprazole is chosen.
23645039 High prevalence of CYP2C19*2 allele in Roma samples realtive to Hungarians.
23640828 CYP2C19 genotypes had significant impact on clopidogrel response and prognosis of patients with stroke.
23629159 Our data indicate how interplays between drug interactions and CYP2C19 genetic variations may influence systemic exposure of CYP2C19 substrates.
23623526 Lansoprazole-associated upper respiratory infections and sore throat in children are related in part to CYP2C19 haplotype.
23618682 A significant proportion of patients demonstrate suboptimal response to clopidogrel which is strongly predicted by polymorphisms in the CYP2C19 allele.
23607088 Platelet reactivity showed gene dose response according to the number of CYP2C19 LOF allele. In conclusion, the Verigene 2C19/CBS assay gave accurate CYP2C19 genotype results which were in well match with the differing on-treatment platelet reactivity.
23588332 The current study suggests that a significant association exists in children between the voriconazole plasma concentration and the CYP2C19 phenotype
23556336 In those patients who were carriers of 1 mutant allele (mutant heterozygotes, CYP2C19*1/*2 or *1/*3), ADP-induced maximum platelet aggregation were significantly different compared with wild-type homozygous patients
23555019 There is association between CYP2C19 loss-of-function allele carriage and stent thrombosis.
23551241 genetic polymorphism is associated with phenobarbital-induced severe cutaneous adverse drug reactions in Thai children
23517020 the CYP2C19*3 allele affects the clopidogrel response in East Asians
23506580 Coexisting polymorphisms of of CYP2C19 and P2Y12 affected clopidogrel responsiveness and clinical outcome more than single polymorphism in Chinese patients with acute coronary syndrome undergoing percutaneous coronary intervention.
23474843 CYP2C19 loss of function alleles was not associated with high on-treatment platelet reactivity
23470885 CYP2C19 loss-of-function genotype is associated with more frequent high platelet reactivity, as assessed by ADP-specific platelet function tests, in Japanese patients.
23469989 genetic association studies in a Han population in China: Data suggest that there are no associations between drug-induced liver injury due to antitubercular agents and 2 SNPs in CYP2C19 (rs11568732, rs4986894) in the population studied.
23429358 Patients carrying at least one CYP2C19 loss-of-function allele (CYP2C19*2, *3) are associated with an increased risk of recurrent vadiovascular events undergoing in Chinese patients undergoing percutaneous coronary intervention.
23413279 Regardless of CYP2C19 phenotype, tivantinib administration results in a partial response in patients with advanced solid tumors.
23412869 Our findings confirm *17 as a regulatory polymorphism enhancing hepatic CYP2C19 expression 2-fold with potential to compensate for the loss of function allele CYP2C19*2
23402725 The CYP2C19 geneotype was associated with more adverse cardiac effects in coronary disease patients receiving clopidogrel.
23364775 CYP2C19/ABCB1 genotype may modify cardiovascular risk among patients on clopidogrel anti-platelet therapy after placement of drug-eluting stents.
23340030 In acute coronary syndrome, clopidogrel and prasugrel have genetic modulation by CYP2C19 *2 and *17 alleles and prasugrel provides greater platelet inhibition, regardless of genotypes. LTPR was associated with a greater risk of bleeding.
23337798 homozygous CYP2C19*2 genotype was an independent risk factor for adverse cardiovascular events in patients with coronary artery disease within 1 year of discharge. Risk of the homozygous CYP2C19*2 genotype significantly reduced after 1 year.
23267857 CYP2C19*17, a gain-of-function polymorphism, is associated with PUD irrespective of etiology.
23257377 The present study shows a significant influence of CYP2C19*2 and *17 alleles on response to chronic treatment by prasugrel 10 mg daily and occurrence of bleeding complications.
23193974 Cytochrome b(5) residues D58 and D65 are essential for the stimulation of CYP2E1 and CYP2C19 activities and that the phospholipid composition significantly influences the b(5)-P450 interaction.
23179471 Report test and reference citalopram 20 mg tablets met the regulatory criteria for assuming bioequivalence in the healthy Chinese male CYP2C19 extensive metabolizers.
23175667 Genotyping of CYP3A5/CYP2C19 in renal transplantation may be of interest when treating with tacrolimus and omeprazole, because CYP2C19*2/*2 variant indirectly elicits an increase of tacrolimus blood levels and the adverse effects described.
23148634 This study provides important data on the pattern of CYP2C19 polymorphisms in Chinese Han subjects, using the largest group of individuals.
23118231 The substrate-binding cavity of P450 2C8 is much larger than that of P450 2C19 and P450 2C9.
23081704 Descriptive Statement This study reveals no association between the metabolic profiles of CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes and both current suicide risk and personal history of suicide attempts.
23074110 Present findings strengthen the evidence of an association between CYP2C19 gene polymorphism and EH prevalence.
23016454 The genetic polymorphism of CYP2C19 681G > A does not cause significant alterations in the pharmacokinetics of clopidogrel
23001453 Carriage of the loss-of-function genetic variants CYP2C19 2 and 3 is significantly associated with attenuated platelet response to clopidogrel and an increased risk of stent thrombosis in Chinese patients treated with stenting.
22984423 The CYP2C19(*)3 polymorphism and oesophageal squamous cell carcinoma were synergistically and significantly associated in Chinese Han patients.
22974728 Genetic variation in CYP2C19 influences post-clopidogrel platelet reactivity in Chinese patients.
22971905 Among Chinese patients with acute coronary syndromes, carriers with 2 CYP2C19 LOF alleles are more prone to high platelet reactivity, which is associated with an increased risk for periprocedural myocardial infarction.
22955794 South Indian ischemic heart disease Patients with CYP2C19 genetic polymorphisms had higher residual platelet activities and were associated with a reduced antiplatelet response to clopidogrel.
22940005 SNPs in CYP2C19*2 were mainly attributed to myocardial infarction and stent thrombosis.
22929815 In coronary artery disease patients on clopidogrel therapy, CYP2C19*2 polymorphism is associated with significantly increased adverse cardiovascular events.
22913530 We detected by SNaPshot((R)) different polymorphisms in CYP2D6 and CYP2C19 in poor metabolizer phenotypes in western Mestizos and five Amerindian groups from Mexico.
22875511 Compared with homozygotes or heterozygotes for the wild-type CYP2C19*2, patients with CYP2C19*2 AA genotype had significantly higher PA on 7 and 21 days post PCI (P<0.05).
22875498 The frequencies of CYP2C19*2, *3 and *17 were 32.4%, 5.8% and 0.4%, respectively.
22873740 The CYP2C19-genotype-dependent differences in the pharmacokinetics and pharmacodynamics of PPIs influence the healing and recurrence of GERD during PPI treatment, suggesting the need for CYP2C19 genotype-based tailored therapy for GERD.
22855348 CYP2C19 genetic variation did not affect the pharmacokinetics and pharmacodynamics of low-dose warfarin.
22839512 Was not found difference in the prevalence of CYP2C19 gene polymorphism in different forms of myocardial infarction and there are no influence on prognosis if the patient follow medical recommendations, including the regular use of clopidogrel.
22785462 CYP2C19 loss-of-function polymorphism might be associated with the incidence of MACE and TLR in association with intra-stent thrombi.
22784880 CYP2C19 phenotype was associated with cessation of leflunomide in patients with rheumatoid arthritis due to toxicity.
22747643 allelic frequency of heterozygous CYP2C19*2 was 8.2% with only one individual found to carry the homozygous genotype of this defective allele
22704413 The CYP2C19*17 allele is associated with enhanced response to clopidogrel and an increased risk of bleeding in patients with blood stasis syndrome of coronary artery disease.
22648560 Proton pump inhibitors esomeprazole and omeprazole are likely to be clinically relevant inhibitors of CYP2C19.
22641027 Present findings support the previously established relationship between CYP2C9 and CYP2C19 genetic polymorphisms and the increased risk to develop PTH toxicity
22624833 In patients with high OTR identified by platelet function testing, the CYP2C19 genotype provides limited incremental information regarding the risk of persistently high reactivity with clopidogrel 150-mg maintenance dosing.
22612904 Cilostazol with its pleotropic effects may be a credible alternative to clopidogrel in DES-treated patients with the CYP2C19 loss-of-function allele, especially during chronic maintenance treatment.
22591668 Carrier status for Loss-of-function CYP2C19 is associated with an increased risk of adverse clinical events in patients with coronary artery disease on clopidogrel therapy despite differences in clinical significance according to ethnicity.
22589111 Using chipCE, we present an optimization for allele separation of CYP2C19 I331V, CYP2C9 R144C, and CYP2C9 I359L polymorphisms employing run temperatures of up to 55 degrees C.
22585284 The data showed that the pharmacokinetics of icotinib differ significantly between homozygous extensive metabolizers (EMs) and heterozygous EMs in CYP2C19
22552318 A systematic review and meta-analysis of the association between cytochrome P450 2C19 genotype and bleeding indicates that CYP2C19 genotype will probably not be a useful predictor of bleeding risk in patients taking clopidogrel.
22491019 These results have important implications for pharmacogenomic association studies involving the CYP2C locus and are clinically relevant when administering CYP2C-substrate medications.
22476388 In the title.
22469723 Western blotting analysis showed low CYP2C19 protein expression not only in samples from the pre- and post-liver transplant recipients but also from the donors.
22450429 Results show a relationship between CYP2C19 loss of function and clopidogrel efficiency. The also show a link between reduced bleeding complications.
22425806 The proportion of the homozygous CYP2C19*2 variant causing total loss of gene function was 1.74%, rate of the heterozygous allele causing reduced enzyme activity was 22.26% in the total population in Hungary.
22418828 Data suggest that CYP2C19 polymorphism is an important determinant of pantoprazole pharmacokinetics.
22377481 In our acute coronary syndrome population, the CYP2C19*2 allele was a medium-term prognostic marker
22374717 The results show that CYP2C19 activity and genotype remains a predictor of clopidogrel pharmacokinetics and antiplatelet response.
22324425 effects of esomeprazole and rabeprazole in relation to pharmacokinetics and CYP2C19 polymorphism.
22318618 Efavirenz enhances omeprazole metabolism in a nonstereoselective manner through induction of CYP3A and CYP2C19 activity.
22304323 CYP2C19 polymorphism does not influence the effectiveness of ticagrelor for coronary heart disease.
22281205 Data suggest that no differences exist in metabolism of the insecticide chlorpyrifos in liver microsomes from subjects homozygous for CYP2C19*2 compared to subjects with wild-type CYP2C19.
22228204 Patients with the CYP2C19*1/*17 and *17/*17 diplotype have a lower magnitude of on-treatment platelet reactivity and are at a 2.7-fold increased risk of postdischarge TIMI major bleeding events after coronary stenting than patients with the *1/*1 genotype
22183943 CYP2C19*3 polymorphism is significantly associated with laryngeal carcinoma in the Chinese Han population.
22180071 The CYP2C19*3 gene polymorphism is associated with breast cancer risk in Chinese Han women.
22154242 Depending on the type of platelet function test differences in the association of on-treatment platelet reactivity with CYP2C19 carrier status are observed.
22123356 Meta-Analysis: Carriers of the CYP2C19*17 variant have greater therapeutic responsiveness to clopidogrel than non-carriers, but they have an increased risk of developing bleeding as well.
22122271 voriconazole therapy failure in a homozygous ultrarapid CYP2C19*17/*17 patient comedicated with carbamazepine.
22118006 The CYP2C19 618A genotype is associated with an increased risk of stent thrombosis following coronary stent placement among Chinese patients with coronary artery disease receiving clopidogrel
22116003 Even though CYP2C19 genotype is associated with variable platelet reactivity, it has no significant clinical influence in an unselected population of non ST elevation acute coronary syndrome.
22088240 CYP2C19 681G > A polymorphism is a determinant of prognosis in coronary heart disease patients receiving chronic clopidogrel treatment after percutaneous coronary intervention.
22071359 The homozygous CYP2C19*2/*2 genotype is an independent determinant of adverse vascular events in Chinese patients with coronary artery disease.
22070512 The efficacy of ilaprazole is not affected by CYP2C19 polymorphisms.
22045970 In East Asians, the CYP2C19 loss-of-function (LOF) allele affects clopidogrel pharmacodynamics according to the number of the CYP2C19 LOF allele. Influence of CYP2C19*2 and *3 alleles on clopidogrel response does not differ.
22030270 CYP2C19 gene variants cut-off levels for on-clopidogrel platelet aggregation.
22028352 This case-control study identified 3 genes (CYP2C19, ABCB1, and ITGB3) and 2 clopidogrel-related factors (loading dose and proton pump inhibitors) that were independently associated with early stent thrombosis
22007612 Loss-of-function polymorphism of the CYP2C19 gene, but not the ABCB1 C3435T and CYP3A5*3 genes, affects the antiplatelet effect of triple antiplatelet therapy
21977947 CYP2C-poor metabolizers (two defective alleles) are rare (<1%) or absent in Guarani in Brazil, whereas intermediate metabolizers (one defective allele) of CYP2C19, CYP2C9 and CYP2C8 substrates account for 11%, 5.5% and 0.6%, respectively, of the cohort
21972404 genetic variants influence clopidogrel pharmacokinetics, pharmacodynamics, and clinical efficacy in post-myocardial infarction patients
21971440 Polymorphisms in CYP2C19 genes do not seem to be related to the occurrence of cognitive dysfunction after non-cardiac surgery in patients anesthetised with propofol.
21916910 investigation of distribution of SNPs in CYP2C19 (rs12248560, rs4986893 and rs4244285) in a Tamilian population in South India; investigation of a theoretical model for the association of SNPs in CYP2C19 with drug metabolism/biotransformation
21913948 genetic association studies in ethnic Chinese populations: first report of interethnic differences (i.e., SNPs) in frequencies of functional CYP2C19 and CYP2D6 genes among Chinese Mongolian, Hui and Han populations
21913914 Homogenous phenomenon of graft liver CYP2C19 genotypes after living donor liver transplantation
21887904 the identification of intermediate and poor drug metabolizers based on CYP2C19 polymorphism can be a basis for the standardization of personalized therapy.
21862109 Results suggest the cut-off levels of PRU and %inhibition to discriminate carriers of CYP2C19 reduced-function allele from noncarriers are useful clinically to provide optimal clopidogrel therapy in patients with stable CAD undergoing PCI.
21861665 CYP2C19 was 7 polymorphisms and greater than 50% of the population carried polymorphisms in either two or all of the CYP2C9, CYP2C19 and CYP2D6 genes.
21831410 Apart from the CYP2C19*2, other genetic variants involved in clopidogrel metabolism and action like CYP2B6*5 and P2RY12 seem to have an important association with HTPR.
21826689 The prevalence of the commonly observed CYP2D6 and CYP2C19 alleles in the Hungarian population corresponds with that of other European populations.
21806387 Genetic variants in CYP2C19 have a gene-dose effect on post-clopidogrel platelet reactivity, with homozygote LOF carriers having the highest risk for HTPR and for adverse ischemic events
21803320 In CYP2C19 carriers,higher clopidogrel maintenance doses overcame clopidogrel low response in fewer than half of clopidogrel low responders who underwent percutaneous coronary intervention for non-ST-segment elevation acute coronary syndrome.
21798861 These results suggest that there is no notable influence of sequence variation in the CYP2C genes on longevity in the examined German population
21795468 omeprazole inactivated CYP2C19 with K(I) values of 1.7 to 9.1 muM and k(inact) values of 0.041 to 0.046 min(-1).
21794898 Results suggest that carriers of the loss-of-function CYP2C19 alleles have an approximately 11.4% higher rate of MACE when they take clopidogrel than noncarriers.
21786436 Intermediate and poor metabolizing CYP2C19 polymorphism is associated with reduced clopidogrel antiplatelet activity in patients with cerebrovascular disease.
21778720 Homozygosity (A/A) for CYP2C19*2 mutant is an independent determinant of prognosis in patients with ACS.
21777277 For reflux esophagitis with complete healing after continuous pantoprazole, the successful shift to on demand therapy is determined by the CYP2C19 genotypes of the patients.
21766908 described drug abuse cases suggest that an association between the presence of CYP2C and VKORC1 allelic variants and cocaine-induced interstitial lung damage is highly likely
21741706 Correlation of CYP2B6, CYP2C19, ABCC4 and SOD2 genotype with outcomes in allogeneic blood and marrow transplant patients.
21692828 Patients commencing warfarin treatment are at risk of bleeding due to excessive anticoagulation caused by overdosing. The interindividual variability in dose requirements is influenced by polymorphisms in genes mediating warfarin pharmacology
21689142 open-label, two-period, randomized, crossover study was designed to determine the effect of CYP2C19 reduced function variants on exposure to active metabolites of, and platelet response to, prasugrel and clopidogrel.
21628721 The CYP2C19*2 loss-of-function polymorphism is associated with a more frequent occurrence of HPR.
21627593 In patients receiving double dose clopidogrel in combination with aspirin we found no worsening of outcomes associated with CYP2C19*2 carriage.
21527445 The PON1 Q192R genotype did not influence platelet response to clopidogrel or the risk of ST in clopidogrel-treated patients, whereas the CYP2C19*2 genotype impacted on both antiplatelet effect of clopidogrel and risk of coronary ST
21511219 In patients with high on-treatment platelet reactivity after PCI, prasugrel is more effective compared with high clopidogrel in reducing platelet reactivity, particularly in CYP2C19*2 carriers.
21511217 Adjunctive cilostazol significantly enhances platelet inhibition and reduces the rate of high on-treatment platelet reactivity, especially in acute myocardial infarction patients with CYP2C19 loss-of-function variants.
21507170 This is the first reported clinical occurrence of CYP2C19 polymorphism identified in a case study of voriconazole toxicity.
21497341 High-density fine-mapping of a chromosome 10q26 linkage peak suggests association between endometriosis and variants close to CYP2C19.
21473286 The results obtained by quenching probe method were absolutely identical to those examined by the conventional direct sequencing. This method will enable point-of-care testing in clinical laboratories and patient-oriented therapy
21383338 These results suggest that the CYP2C19 genotype is the major determinant of the wide pharmacokinetic variability of voriconazole
21380557 These data show no significant difference in the frequency of CYP2C19 allelic variants when compared to Caucasian populations.
21358751 250 Ashkenazi Jewish and 135 Sephardi Jewish individuals were genotyped for CYP2C19*2-*10, *12-*17, *22 and P-glycoprotein (ABCB1) c.3435C>T. CYP2C19*4, a loss-of-function allele, was identified in linkage disequilibrium with *17.
21332417 Hypertension is associated with the AA genotype of single nucleotide polymorphism (rs10509676) in the human CYP2C19 gene. The A-G haplotype appears to be a risk factor and the T-T haplotype may be a protective factor of hypertension in Chinese Han people.
21315147 Results indicate that both hydrolysis single nucleotide polymorphism analysis and high-resolution melting curve (HRM) analysis successfully genotyped the 114 liver donors for CYP2C19 *2.
21302482 The CYP2C19*2 gene mutation is associated with clopidogrel resistance, and could increase the risk of post-PCI cardiovascular event recurrence in patients with coronary atherosclerotic heart disease.
21299635 Mutation in CYP2C19 is associated with pentamidine toxicities in allogeneic stem cell transplant patients.
21247447 Inter-ethnic differences in the ABCB1 and CYP2C19 variant allele frequencies exist in the Brazilian general population plus Amerindians. This information could help in designing more cost effective programs for individualizing clopidogrel therapy.
21237322 This article reviews the role of genetic polymorphisms in the clinical impact of oral inhibitors of the platelet P2Y12 adenosine diphosphate (ADP) receptor
21215696 genotyping for CYP2C19 SNP's may be of benefit in the selection of appropriate anti-platelet therapy.
21212520 These results suggest the metabolic capacity of CYP2C19 in Japanese small intestine may play as important a role as the liver in drug metabolism.
21192344 Variations in CYP2C19 were associated with tolerance and remission in a large sample of White non-Hispanic patients treated with citalopram.
21173785 Report impact of population diversity on the distribution of CYP2C19 polymorphisms among Brazilians.
21160212 Our data suggest that the CYP2C19*2 heterozygous genotype may be involved in the development of bronchial asthma.
21152987 The results also suggest the role of activating transcription factor-2 and CCAAT displacement repressor protein on CYP2C19 gene transcription.
21132257 CYP2C19 phenotypes in carriers could predict the pharmacotherapeutic efficacy and probability of eradication.
21108610 CYP2C9*2, CYP2C19*2, and CYP2D6*4 polymorphisms do not appear to play a role in type 2 diabetes mellitus
21108329 patients homozygous for CYP2C19 *2 allele had significantly worse PFS and OS
21099121 Suggest that CYP2C19*2 polymorphism is associated with subclinical thrombus formation among Japanese patients receiving clopidogrel.
21079055 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21075428 Carriage of CYP2C19*3 allele is associated with diminished antiplatelet effect of clopidogrel, which may be as potent as the loss-of-function effect of CYP2C19*2 allele.
21075428 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21071160 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
21054464 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21054462 this study reported that in the Korean population tested, the CYP2C19*2 and CYP2C19*3 alleles were relatively frequently found, whereas the frequency of CYP2C19*17 was very low.
21054462 Observational study of genotype prevalence. (HuGE Navigator)
21047200 CYP2C19*2 genotype may be a predictive factor for survival in breast cancer patients using tamoxifen.
21047200 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21038076 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20979470 Our study shows that CYP2C19 loss-of-function variants do not modify the efficacy and safety of clopidogrel for acute coronary syndromes or atrial fibrillation.
20979470 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20978260 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20976881 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20970553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20965456 No significant differences in antiplatelet effect of clopidogrel according to CYP2C19 status, although the reduction in reactivity was minimal in the small number of patients homozygous for loss of function alleles.
20965456 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20941486 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20926021 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20924183 The CYP2C19*2 allele is an predictor of suboptimal reperfusion in patients with myocardial infarct undergoing reperfusion with stenting after pretreatment with clopidogrel and may increase the risk of all-cause mortality
20924183 Observational study of gene-disease association. (HuGE Navigator)
20890775 discusses linkage disequilibrium between the CYP2C19*17 and CYP2C8*2 alleles in populations of African descent
20885015 Findings indicated both similarities and differences in the distribution of polymorphic alleles of CYP2C9, CYP2C19 and VKORC1 between southern and northern Iranians; CYP2C19*2 and CYP2C19*3 allelic frequencies were similar to the Caucasian population
20885015 Observational study of genotype prevalence. (HuGE Navigator)
20863179 Observational study of genetic testing. (HuGE Navigator)
20857895 Observational study of gene-disease association. (HuGE Navigator)
20845310 Data found that the allele frequencies of the CYP2C9*2 and CYP2C9*3 allelic variants in the studied Mongolian population of China were similar to those reported for other Asian populations.
20845310 Observational study of genotype prevalence. (HuGE Navigator)
20845077 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20838991 The CYP2C19 genotype played a considerable role in the pharmacokinetic characteristics of rabeprazole, and this might need to be taken into account for clinical use.
20838991 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20833683 Variant alleles of this gene increase the risk of stent thrombosis in patients on dual aspirin and clopidogrel therapy after PCI
20833683 Observational study of gene-disease association. (HuGE Navigator)
20831548 Observational study of gene-disease association. (HuGE Navigator)
20831536 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20831535 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20826260 Study found a protective effect for carriers of an increased-function CYP2C19*17 T-allele with significantly lower rates of target lesion revascularization and major adverse cardiovascular events.
20826260 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20823393 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20804307 Results showed that CYP2C19 polymorphism influences the therapeutic efficacy of omeprazole in the treatment of Iranian patients with erosive reflux esophagitis.
20804307 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20801498 CYP2C19 and ABCB1 genotypes are known to influence the effects of clopidogrel.
20801498 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20801494 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20724801 higher prevalence of the CYP2C19 mutant allele is associated with inadequate pre-procedural platelet inhibition in pateints undergoing scheduled percutaneous coronary intervention.
20724801 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20716514 Observational study of genetic testing. (HuGE Navigator)
20716239 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20708365 Increased and tailored clopidogrel loading dose according to platelet reactivity monitoring overcome HTPR in carriers of the loss-of-function CYP2C19*2 polymorphism.
20708365 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20684753 Polymorphisms in CYP2C19 is not associated with drug sensitivity in patients with Multiple Myeloma.
20684753 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20673183 Significant differences are found in CYP2C19 activity in Chinese subjects who are homozygous or heterozygous for the enzyme.
20673183 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20669013 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20665013 CYP2C19*17 is a frequent genetic variant in Nordic populations that exists in strong linkage disequilibrium with wildtype CYP2C8*1 and CYP2C9*1 alleles, which makes it a determinant for a haplotype exhibiting an efficient CYP2C substrate metabolism
20665013 Observational study of genotype prevalence. (HuGE Navigator)
20650435 Among PCI-treated patients receiving high-dose clopidogrel, carriage of CYP2C19 variant relates to increased platelet reactivity(PR) and predicts risk of high post treatment PR.
20650435 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20637959 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20633187 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20620727 Reduced CYP2C19 function appears to expose clopidogrel-treated patients to excess cardiovascular risk and mortality.
20620727 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20602612 Functional variants from the gene encoding CYP2C19 were highly polymorphic in North Indian epilepsy patients, and might account for differential drug response to first-line anticonvulsants.
20602612 Observational study of gene-disease association. (HuGE Navigator)
20581929 The presence of CYP2C19*17 may be low in Pacific people and may lead to altered efficiency at metabolising some common drugs such as omeprazole.
20581929 Observational study of genotype prevalence. (HuGE Navigator)
20573087 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20565970 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20559522 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20549497 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20549256 A genetic polymorphism of CYP2C19 is associated with susceptibility to biliary tract cancer
20549256 Observational study of gene-disease association. (HuGE Navigator)
20533108 Our findings provide evidence that the cytochrome P450 2C19 genotype is useful to predict the success of Helicobacter pylori eradication.
20533108 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20531370 This study confirms the increased activity of the CYP2C19*17 allele and shows increased metabolism of drugs that are metabolized by CYP2C19, including amitriptyline and citalopram.
20531370 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20528170 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20510210 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20499227 Observational study of gene-disease association. (HuGE Navigator)
20492469 CYP2C19 *2 and *17 allele carriage are independent predictors for the antiplatelet effect of chronic clopidogrel therap
20492469 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20492467 the CYP2C19 genotype may have a role in response to prasugrel instead of clopidogrel
20492467 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20492431 Observational study of gene-disease association. (HuGE Navigator)
20468063 Our results suggest for the first time that the CYP2C19 polymorphism might be of importance for depressive symptoms, as shown here for older European adults.
20468063 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20460345 The CYP2C19*3 polymorphism and CAD were synergistically and significantly associated in Chinese Uighur patients.
20460345 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20457439 Correlation of CYP2C19 genetic polymorphisms with helicobacter pylori eradication in patients with cirrhosis and peptic ulcer.
20457439 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20430047 Observational study of gene-disease association. (HuGE Navigator)
20414645 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20390258 Observational study of gene-disease association. (HuGE Navigator)
20376628 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20373852 Observational study of gene-disease association. (HuGE Navigator)
20360782 Carriers of a genetic polymorphism in the cytochrome P450 2C19 gene, which occurs more frequently in the Oceanic ancestry group, have a higher incidence of stent thrombosis and cardiovascular death whilst on the thienipyridine clopidogrel.
20358205 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20356512 Observational study of gene-disease association. (HuGE Navigator)
20351750 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20350136 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20350051 Glycyrrhizin did not significantly affect the activity of CYP2C19.
20350051 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20349052 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20309015 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20297661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20236133 Observational study of gene-disease association. (HuGE Navigator)
20235787 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20223877 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20207952 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20206639 These data indicate that GATA-4 plays an important role in the transcriptional regulation of CYP2C19 expression
20179710 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20163283 Relation of CYP2C19 loss-of-function polymorphism to the occurrence of stent thrombosis (Review)
20147896 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20113968 There is no association between polymorphisms in the CYP2C19 gene and severity of endometriosis.
20113968 Observational study of gene-disease association. (HuGE Navigator)
20088379 Observational study of gene-disease association. (HuGE Navigator)
20083681 CYP2C19*17 carrier status is significantly associated with enhanced response to clopidogrel and an increased risk of bleeding.
20083681 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20078610 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20064729 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20040040 Letter: Decreased platelet response to clopidogrel (75 mg day-1) associated with the CYP2C19*2 loss-of-function polymorphism can be reversed by doubling the clopidogrel maintenance dose. Lansoprazole also decreases the effect of clopidogrel.
20015960 Observational study of gene-disease association. (HuGE Navigator)
20002085 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19968574 The eradication rates of Helicobacter pylori infection are significantly different between patients who are CYP2C19 extensive metabolizers and poor metabolizers--REVIEW
19961004 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19954746 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19954515 Allele frequency distributions for CYP2C19 among the Ghanaian population are comparable to other African ethnic groups but significantly differ from Caucasian and Asian populations
19954515 Observational study of genotype prevalence. (HuGE Navigator)
19942749 This study demonstrated a direct correlation between CYP2C19 genetic polymorphism and H. pylori eradication in north Indian patients with gastritis.
19942749 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19940233 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19934793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19933691 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19932784 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19928008 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19926050 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19907421 Observational study of gene-disease association. (HuGE Navigator)
19904250 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19891553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19890215 These findings suggest that CYP2C19 genotypes are important determinants of nelfinavir pharmacokinetics and virologic response in HIV-1-infected children.
19890215 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19884907 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19881258 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19847408 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19841156 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19840783 the influence of CYP2C19 and CYP2D6 in the disposition of citalopram
19840783 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19823875 Studies indicate that of the 200 most clinically used drugs, 73% require metabolism and 72% of the enzymes responsible are members of the P450 superfamily, predominantly CYP3A4, CYP2D6, CYP2C19, CYP2C9, and CYP1A2.
19821196 the most common CYP2C19 genotype was wild type CYP2C19 in dyspeptic Turkish patients
19821196 Observational study of gene-disease association. (HuGE Navigator)
19817997 CYP2C19 genotype was associated with high platelet reactivity during conventional dual antiplatelet therapy.
19817997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19773541 CYP2C19-mediated clearance of S-citalopram occurs via N-desmethylation and the fomration of a propionic acid metabolite.
19761366 CYP2C19*17 allele determines antimalarial biguanide metabolic profile at the CYP2C19/CYP2C9 locus
19761366 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19745563 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19712984 Optimal inhibition of platelet reactivity can be obtained in patients undergoing percutaneous coronary intervention despite loss of function of CYP 2C19 2*.
19706858 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19706858 CYP2C19*2 genotype was associated with diminished platelet response to clopidogrel treatment and poorer cardiovascular outcomes.
19702490 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19696793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19693007 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19661214 Individuals of the Korean population carrying CYP2C19*26 variant have lower activity for metabolizing CYP2C19 substrate drugs.
19661214 Observational study of genotype prevalence. (HuGE Navigator)
19638460 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19636337 We detected 48 genetic variants in CYP2C19 in Han Chinese. A total of 15 of them are novel, including two polymorphisms in putative transcriptional factor-binding sites.
19636337 Observational study of genotype prevalence. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19624462 The existence of poor responders not carrying the LoF mutation and responders carrying the mutation indicates that other factors such as body weight also influence the responsiveness to clopidogrel.
19624462 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19621685 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19617466 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593168 Study shows a significant in vivo role of CYP2C19 and the P-gp transporter in the pharmacokinetics of clozapine.
19593168 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593158 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19583677 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19576320 Th researchers found evidence of an association between CYP2C19*3 single nucleotide polymorphisms and the development of clopidogrel resistance in Korean patients with coronary artery disease.
19576320 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19552744 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19546880 Observational study of genotype prevalence. (HuGE Navigator)
19534586 towards form-selective substrates. Rates of diclofenac 4 -hydroxylation by P450 2C9 and luciferin H-EGE metabolism by P450 2C19 were higher for the MALLLAVFL-modified forms compared with the (delta 3-20) truncated forms
19531897 CYP2C19 polymorphisms are frequent in Japanese, and the antiplatelet effect of clopidogrel is strongly affected by them
19531897 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19516253 CYP2C19 polymorphisms play an important role in the metabolism of cilostazol only in individuals with the CYP3A5*3/*3 genotype
19516253 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19499406 that CYP2C19*2 heterozygote genotype has higher risk of developing endometriosis. CYP2C19*2 allele gene polymorphisms may be associated with genetic susceptibility of endometriosis.
19499406 Observational study of gene-disease association. (HuGE Navigator)
19496924 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19474452 Observational study of genetic testing. (HuGE Navigator)
19430176 Observational study of genotype prevalence. (HuGE Navigator)
19429918 Variation in the CYP2C19 gene in patients with stable Coronary Disease contributes to reduced exposure to clopidogrel's active metabolite and a corresponding reduction in P2Y(12) inhibition, but has no significant influence on the response to prasugrel.
19429918 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19424794 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19415824 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19415745 Single nucleotide polymorphisms in the CYP2C19 is Associated with premenopausal breast cancer women.
19415745 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19414633 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19407662 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19404631 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19398604 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19350405 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19348299 All the patients received first line eradication therapy during 7 days. Its efficiency was found to be dependent on CYP2C19 polymorphism among other factors.
19348299 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19337788 Clopidogrel patients presenting with repeat acute coronary syndrome do not have higher frequency of CYP2C19 variant alleles compared to a control group.
19337788 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19299322 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19268736 CYP2C19*2 allele was associated with the occurrence of ST or ST and cardiac mortality in high-risk vascular patients on dual-antiplatelet treatment
19268736 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19261446 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19259653 CYP2C19 genotype is associated with symptomatic recurrence of GERD during maintenance therapy with low-dose lansoprazole.
19259653 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19246508 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19238367 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19236548 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19220726 showed that individuals carrying one or more *2 or *3 mutated allele(s) of the CYP2C19 gene exhibited higher rate of HPPR and significantly decreased response to clopidogrel than those with wild-type alleles in Asian acute coronary syndrome patients
19220726 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19199010 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19193970 Observational study of gene-disease association. (HuGE Navigator)
19193675 CYP2C19*2 carrier status is significantly associated with an increased risk of ST following coronary stent placement.
19193675 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19192051 Observational study of gene-disease association. (HuGE Navigator)
19176055 When CYP2C19 was inhibited, the anti-myeloma activity of thalidomide was also inhibited.
19172254 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169185 Observational study of gene-disease association. (HuGE Navigator)
19166419 The efficacy of omeprazole- and lansoprazole-based first-line triple therapies at the standard doses is dependent on CYP2C19 genotype status, which appears not to affect the efficacy of the regimens including rabeprazole.
19166419 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19164093 Observational study of genotype prevalence. (HuGE Navigator)
19156902 the CYP2C19 genotype is not likely to have a clinically significant impact on prognosis, endometrial thickness, BMD, or total cholesterol levels in Japanese patients with breast cancer who are treated with adjuvant tamoxifen.
19156902 Observational study of gene-disease association. (HuGE Navigator)
19151603 Pharmacogenetic variation at CYP2C19 in different population groups
19139162 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19136640 Observational study of genetic testing. (HuGE Navigator)
19129087 The results of this study indicated that other regional populations of Papua New Guinea also have a relatively high incidence of the CYP2C19 genetic polymorphism compared with Caucasian populations.
19129087 Observational study of genotype prevalence. (HuGE Navigator)
19108880 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19106084 Among persons treated with clopidogrel, carriers of a reduced-function CYP2C19 allele had significantly lower levels of the active metabolite of clopidogrel, diminished platelet inhibition, and a higher rate of major adverse cardiovascular events.
19106084 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19106083 Among patients with an acute myocardial infarction who were receiving clopidogrel, those carrying CYP2C19 loss-of-function alleles had a higher rate of subsequent cardiovascular events than those who were not.
19106083 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19102714 Observational study of genotype prevalence. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19069365 This study determined the prevalence of clinically relevant allele variants in a Puerto Rican population and determined whether the allele distributions for gene mutations met Hardy-Weinberg equilibrium
19038035 Despite the observed alterations, tg-CYP2C18&19 did not show any macroscopic or microscopic pathology at the examined age. Hence, these hemizygous transgenic mice were considered to be viable and healthy animals.
19033450 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19025845 Observational study of gene-disease association. (HuGE Navigator)
19002442 Observational study of genotype prevalence. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18982321 the presence of the CYP2C19*17 allele results in ultra-rapid metabolism of voriconazole after a single oral dose
18982321 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18979093 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18957504 CYP2C19 and CYP3A4 can 21-hydroxylate progesterone but not 17OHP, possibly ameliorating mineralocorticoid deficiency, but not glucocorticoid deficiency.
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18854824 in a cancer population genotyping for CYP2C19 would significantly underestimate the number of phenotypic poor metabolizers of drugs, such as cyclophosphamide, which may be metabolised by this enzyme.
18854824 Observational study of gene-disease association. (HuGE Navigator)
18854779 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18823430 CYP2C19 genotype did not affect the eradication rate of Helicobacter pylori infection by triple therapy with pantoprazole, amoxycillin and clarithromycin.
18823430 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18781853 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18765869 marked interindividual variations in the pharmacokinetics and pharmacodynamics of proton pump inhibitors with respect to CYP2C19 phenotypes
18751689 Report optimal dose regimens of esomeprazole for gastric acid suppression with minimal influence of the CYP2C19 polymorphism.
18751689 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18702650 Esomeprazole 40 mg daily can be effective for RE-CD patients with different CYP2C19 genotypes. BMI > 25 kg/m(2) is an independent risk factor to determine the healing of RE-CD by esomeprazole.
18677622 There are significantly higher serum concentrations associated with alleles encoding defective CYP2C19 metabolism in psychiatric patients.
18677622 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18654768 A clinically significant difference in escitalopram or omeprazole kinetics between the CYP2C19 genotypes appears unlikely.
18644391 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18641551 the CYP2C19 genotype affects the zonisamide metabolism in Japanese epileptic subjects
18641551 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18637061 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18581106 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18577829 Coexisting polymorphisms of the genes affecting clopiogrel resistance may influence platelet activation
18577829 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18551037 The activity of individual P450 oxidoreductase mutants may vary greatly depending on the electron recipient used to assay activity.
18532997 the CYP2C19 pharmacogenomic status is a determinant for the formation of the active metabolite of clopidogrel and its antiplatelet effects to the active metabolite in healthy subjects
18521743 We observed a decreased breast cancer risk for carriers of the CYP2C19*17 allele
18521743 Observational study of gene-disease association. (HuGE Navigator)
18520598 the pharmacokinetics of warfarin enantiomers were different between the CYP2C19 genotypes
18520598 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18520596 no significant associations between the CYP2c19 genotype and suicidal behavior or substance abuse disorder were noted
18520596 Observational study of gene-disease association. (HuGE Navigator)
18518848 Observational study of genotype prevalence. (HuGE Navigator)
18511451 analysis of amino acid residues that confer CYP2C19 selective activity to CYP2C9
18510611 Observational study of gene-disease association. (HuGE Navigator)
18496682 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18496131 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18482659 Patients carrying at least one CYP2C19*2 allele are more prone to high-on clopidogrel platelet reactivity, which is associated with poor clinical outcome after coronary stent placement
18482659 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18466100 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18425152 Observational study of genotype prevalence. (HuGE Navigator)
18423013 Observational study of gene-disease association. (HuGE Navigator)
18399167 CYP2C19 genotype has no difference between multiple myeloma patients and healthy persons, but exhibits an effect on the treatment efficacy of thalidomide for multiple myeloma.
18399167 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18394438 The present data suggest that the CYPC19*2 allele influences post-treatment platelet reactivity and clopidogrel response in patients with non-ST elevation acute coronary syndromes
18394438 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18382661 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18356043 Data concluded that CYP2C9, CYP2C19 and CYP3A4 are the primary cytochromes in the bioactivation of lynestrenol in vitro, while CYP3A4 catalyses the further metabolism of norethindrone.
18346178 CYP2C19*2 and CYP2C19*3 genetic polymorphisms reduced clopidogrel inhibition of ADP-induced platelet aggregation, with the degree of inhition dependent on the genetic polymorphism present.
18346178 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18323861 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18319058 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18312490 The effect of CYP2C19*18 and CYP2C19*19 alleles on omeprazole 5-hydroxylation was studied using recombinant CYP2C19 enzymes.
18294333 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18241287 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18241283 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18240905 CYP2C19 alleles reclassifies Jewish individuals from either extensive- or intermediate- to the intermediate- or poor-metabolizer phenotypes.
18240905 Observational study of genotype prevalence. (HuGE Navigator)
18240903 Observational study of genotype prevalence. (HuGE Navigator)
18231117 Observational study of gene-disease association. (HuGE Navigator)
18224311 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18223462 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18214455 Among the 43 CYP2C19 poor metabolizers, 24 were CYP3A5*3/*3 carriers and 19 were CYP3A5*1 carriers (CYP3A5*I/*I in one subject and CYP3A5*1/*3 in 18 subjects).
18211619 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18205890 CYP2C19 may be considered as a new candidate gene for cardiovascular risks via inflammation.
18205890 Observational study of gene-disease association. (HuGE Navigator)
18154472 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18061941 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18057705 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18024866 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18021343 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18004210 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17992535 The genotypes of CYP2C19 and of CYP2D6 were examined. An association of the metabolic phenotype with genetic disposition was observed.
17992535 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17978853 Observational study and meta-analysis of genotype prevalence. (HuGE Navigator)
17966194 Observational study of gene-disease association. (HuGE Navigator)
17934830 The improvement ratios of ulcer area in homozygous CYP2C19 was significantly smaller than that of heterozygous CYP2C19 treated with rabeprazole and omeprazole.
17934830 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17924835 pharmacogenetics of this enyme should be taken into consideration for the personalization of a proton pump inhibitor in gastro-esophageal reflux [REVIEW]
17924835 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17922881 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17909762 Observational study of genetic testing. (HuGE Navigator)
17900275 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17900275 Common loss of function polymorphisms of CYP2C19 and CYP2C9 are associated with decreased exposure to the active metabolite of clopidogrel but not prasugrel.
17875119 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17875119 the pharmacodynamics and pharmacokinetics of omeprazole (OPZ) are dependent of the CYP2C19 genotype status in Chinese people
17868191 Smoker patients having CYP2C9*2 heterozygote genotype have 3.7-fold risk of developing atherosclerosis. CYP2C19*3 heterozygote alleles are more frequent in patients than in controls and it is related with a three-fold risk of atherosclerosis.
17827141 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17697203 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17697139 CYP2C19 and CYP3A4 gene polymorphisms have a role in clopidogrel responsiveness in healthy subjects
17681590 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17680025 Observational study of gene-disease association. (HuGE Navigator)
17680025 study provides strong evidence that transplant-related mortality and morbidity are influenced by gene polymorphisms of CYP2C19
17667959 CYP2c19 and CYP2d6 genotypes can be used to predict imipramine+desipramine plasma levels in in depressed patients.
17667959 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17667801 Observational study of genotype prevalence. (HuGE Navigator)
17666363 Polymorphisms of CYP2C19 gene are associated with the efficacy of thalidomide based regimens in multiple myeloma
17635181 Observational study of genotype prevalence. (HuGE Navigator)
17635176 Observational study of genotype prevalence. (HuGE Navigator)
17625515 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17625515 Homozygous CYP2C19*17 genotype is associated with lower serum concentration of escitalopram, which might imply increased risk of therapeutic failure.
17623107 Observational study of genotype prevalence and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17623107 Evaluate the genotype and phenotype status of CYP2C19 in Colombian Mestizos, in order to contribute to the use of appropriate strategies of drug therapy for this population.
17562299 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17559380 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17504998 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17502835 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17487889 Glu-300 and Phe-476 are important in stereoselective oxidation of hexobarbital
17455109 results suggest that Ser51Gly substitution in CYP2C19.19 decreases the affinity toward S-mephenytoin of CYP2C19 enzyme, and imply that the genetic polymorphism of CYP2C19*19 also causes variations in the clinical response to drugs metabolized by CYP2C19
17450472 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17439410 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17439410 Study shows an obvious relationship between CYP2C19 genotype and omeprazole hydroxylation phenotype in the different ethnic populations of China.
17433262 CYP219 has been demonstrated to be involved in the metabolism of voriconazole.
17424941 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17418993 An inhibition assay was developed and validated for CYP2C19 in liver microsomes.
17417917 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17410461 In CYP2C19 homozygous extensive metabolizers, the acid-suppressive effect of omeprazole is no potent compared to heterozygous or poor metabolizers.
17407229 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17377957 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17358097 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17357148 Observational study of gene-disease association. (HuGE Navigator)
17357148 a significant association between CYP2C19 activity and harm avoidance is present in Japanese
17304159 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17298483 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17295875 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17290075 No relationship between CYP2C19 polymorphism and susceptibility to gastric and colorectal cancers.
17279092 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17279092 no evidence to support CYP2C19 genetic polymorphisms as predictable potential risk factors for drug-induced idiosyncratic liver injury
17269966 Observational study of gene-disease association. (HuGE Navigator)
17215846 Observational study of gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
17203292 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17201743 Observational study of genotype prevalence. (HuGE Navigator)
17178267 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17112810 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17052843 Observational study of gene-disease association. (HuGE Navigator)
17052843 The present study thus suggests that the CYP2C19 polymorphism affects personality traits of Japanese females.
17048007 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17047492 Clinical trial of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17047431 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17003844 Observational study of gene-disease association. (HuGE Navigator)
16960452 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16946555 Observational study of genotype prevalence. (HuGE Navigator)
16946555 The poor metabolizers phenotype and the frequencies of CYP2C19 defective alleles, particularly CYP2C19*3 among these three Southeast Asian ethnics appeared to be lower than other Asian populations.
16937451 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16924387 Observational study of genotype prevalence. (HuGE Navigator)
16912869 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16911688 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16908943 Analysis of CYP2C19 enzyme genotype indicated the patient was a homozygous extensive metabolizer, considered a poor responder for omeprazole treatment for duodenal ulcer.
16890578 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16890574 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16873909 Observational study of gene-disease association. (HuGE Navigator)
16863547 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16862439 The constructs, CYP2C9/BMR, CYP2C19/BMR and CYP3A4/BMR are well expressed in Escherichia coli as holo proteins.
16855453 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16815316 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16815315 Observational study of genotype prevalence. (HuGE Navigator)
16812949 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16789993 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16783561 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16772608 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16772608 the CYP2C19*2 loss-of-function allele is associated with a marked decrease in platelet responsiveness to clopidogrel in young healthy male volunteers
16771603 Observational study of genotype prevalence. (HuGE Navigator)
16740190 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16641871 CYP2C19 mRNA expression is highest in hepatocarcinoma tissue, moderate in adjacent normal liver tissue, and absent in other cancer tissues and their adjacent normal tissues.
16638864 Observational study of gene-disease association. (HuGE Navigator)
16595916 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16487225 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16487224 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16413245 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16338280 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16338280 Results show that the CYP2C19 genotype affects diazepam pharmacokinetics and emergence from general anesthesia.
16338278 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16338278 CYP2C19 genotype is unrelated to the esomeprazole-induced healing of gastroesophageal reflux disease.
16338275 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16268979 Observational study of gene-disease association. (HuGE Navigator)
16267764 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16261363 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16239354 Observational study of gene-disease association. (HuGE Navigator)
16236141 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16232205 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16231968 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16231968 Some of the elderly homozygous extensive metabolizers (EMs), as well as heterozygous EMs, have a metabolic activity similar to poor metabolizers, and the CYP2C19 genotype may not be as useful as phenotyping in the elderly.
16220110 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16220110 influence of CYP2C9, CYP2C19 and ABCB1 genetic polymorphisms on phenytoin metabolism in a Black population
16198656 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16183265 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16141610 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16133961 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16116487 Observational study of gene-disease association. (HuGE Navigator)
16048566 Observational study of gene-disease association. (HuGE Navigator)
16025294 Observational study of genotype prevalence. (HuGE Navigator)
16024198 Observational study of gene-disease association. (HuGE Navigator)
16021435 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16012079 In renal-transplant recipients who are CYP2C19 extensive metabolizers, there is less stereoselective difference in the pharmacokinetics disposition the enantiomers of rabeprazole than those of lansoprazole.
16006997 Observational study of gene-disease association. (HuGE Navigator)
15976989 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15963095 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15963082 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15952098 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15952098 SNPs of CYP2C19 and 23S rRNA of H pylori using RUT-positive gastric mucosal samples could be predictable determinants for H pylori eradication by triple therapy.
15932363 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15903128 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15856433 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15855721 Observational study of gene-disease association. (HuGE Navigator)
15842554 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15813658 Observational study of gene-disease association. (HuGE Navigator)
15776277 Observational study of genotype prevalence. (HuGE Navigator)
15776277 Polymorphism of CYP2C19 gene is involved in the metabolism of various drugs used clinically.
15752376 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15715938 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15691505 Observational study of genetic testing. (HuGE Navigator)
15691303 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15662508 Observational study of genotype prevalence, gene-disease association, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15660966 Observational study of genotype prevalence. (HuGE Navigator)
15651900 Observational study of genotype prevalence. (HuGE Navigator)
15639978 Observational study of genotype prevalence. (HuGE Navigator)
15612662 Observational study of genotype prevalence. (HuGE Navigator)
15608563 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15590749 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15569425 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15496639 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15448955 Observational study of gene-disease association. (HuGE Navigator)
15447734 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15385837 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15385836 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15371981 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15349706 Observational study of gene-disease association. (HuGE Navigator)
15327595 Observational study of genotype prevalence. (HuGE Navigator)
15301728 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15285851 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15284537 Observational study of gene-disease association. (HuGE Navigator)
15248218 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15222046 Observational study of gene-disease association. (HuGE Navigator)
15222046 CYP2C19 may participate in the activation of procarcinogen of esophagus cancer, stomach cancer and lung cancer, but may involve in the detoxification of carcinogens of bladder cancer.
15205367 Clinical trial of gene-environment interaction. (HuGE Navigator)
15177309 Observational study of genotype prevalence. (HuGE Navigator)
15177309 CYP2C19, an isoform contributing to the clearance of S-mephenytoin, diazepam, omeprazole, proguanil, citalopram, R-warfarin and many antidepressants."
15171646 Observational study of genotype prevalence. (HuGE Navigator)
15145965 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15119530 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15090156 Observational study of genetic testing. (HuGE Navigator)
15068562 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15025747 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15017629 Clinical trial of gene-disease association. (HuGE Navigator)
14998561 P. 497: "Poor CYP2C19 metabolizers are rate in Italy..." P. 494: "...[I]n the Japanese population, ... poor metabolizers of the CYP2C19 are frequently observed."
14990013 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14695703 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14659971 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14653835 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14636465 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14634838 Observational study of genotype prevalence. (HuGE Navigator)
14634042 The ontogeny of CYP2C9 and -2C19 were dissimilar among both fetal and 0- to 5-months postnatal samples, implying different developmental regulatory mechanisms.
14616425 Observational study of genotype prevalence. (HuGE Navigator)
14583683 Observational study of genotype prevalence. (HuGE Navigator)
14583683 Analysis of the Sepik populations of Papua New Guinea suggest an increase of CYP2C19 null allele frequencies during the colonization of Melanesia.
14520122 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
13680037 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12975335 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12963435 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12950145 Observational study of genotype prevalence. (HuGE Navigator)
12950145 The prevalence of mutations of allelic variant predict genotype frequency in the croatian populations.
12919183 Observational study of genotype prevalence. (HuGE Navigator)
12900872 CYP2D6 and CYP2C19 do not significantly contribute to the metabolism of Methaqualone; although interindividual differences in the monitored metabolic patterns were noted, no marked difference could be related to a CYP2D6 or CYP2C19 polymorphism.
12900870 Using a chiral micellar electrokinetic capillary chromatography assay, the aromatic hydroxylation of Mephenytoin catalyzed by CYP2C19 was confirmed to be highly stereoselective; CYP2C19 also provided enhanced formation of R-EDDP from methadone
12879168 Observational study of genotype prevalence. (HuGE Navigator)
12835613 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12835613 There is an association between blood carisoprodol: meprobamate concentration ratios and CYP2C19 genotype.
12823155 Observational study of gene-disease association. (HuGE Navigator)
12809821 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12698310 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12656699 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12642692 Clinical trial of gene-environment interaction. (HuGE Navigator)
12642692 CYP2C19 polymorphism is associated with pharmacological effects of thalidomide in prostatic neoplasms
12623762 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12534411 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12496751 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12468438 Observational study of gene-disease association. (HuGE Navigator)
12445035 Observational study of gene-environment interaction. (HuGE Navigator)
12419832 Observational study of gene-disease association. (HuGE Navigator)
12386647 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12360109 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12360109 contributes to the biotransformation and E-and Z-doxepin in healthy volunteers
12235924 Observational study of gene-disease association. (HuGE Navigator)
12222750 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12172336 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12142727 Observational study of gene-disease association. (HuGE Navigator)
12130704 Expression and induction in primary culture of hepatocytes
12121503 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12047484 Observational study of genotype prevalence. (HuGE Navigator)
11956668 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11927837 Observational study of genotype prevalence. (HuGE Navigator)
11908757 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11865668 Observational study of gene-disease association. (HuGE Navigator)
11836688 Observational study of genotype prevalence. (HuGE Navigator)
11829201 Observational study of genotype prevalence. (HuGE Navigator)
11791894 concordance between the in vitro activity of OMZ hydroxylase and the CYP2C19 genotype in North Indians
11785712 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11773867 Observational study of gene-environment interaction. (HuGE Navigator)
11763000 Observational study of gene-disease association. (HuGE Navigator)
11713950 Observational study of gene-environment interaction. (HuGE Navigator)
11686476 Observational study of genotype prevalence. (HuGE Navigator)
11474773 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11372584 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11263781 Observational study of gene-environment interaction. (HuGE Navigator)
11240980 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11207032 Observational study of genotype prevalence. (HuGE Navigator)
11037802 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDPFVVLVLCLSCLLLLSIWRQSSGRGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFG      1 - 70
LERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRS     71 - 140
IEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVST    141 - 210
PWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQS    211 - 280
EFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDA    281 - 350
VVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFK    351 - 420
KSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV    421 - 490
//

Text Mined References (813)

PMID Year Title
27348249 2016 Association Between CYP2C19 Loss-of-Function Allele Status and Efficacy of Clopidogrel for Risk Reduction Among Patients With Minor Stroke or Transient Ischemic Attack.
27239927 2016 [The possibility of selecting optimal antiplatelet therapy in patients with coronary heart disease in terms of CYP2C19 polymorphism].
27166533 2016 Variation in pharmacokinetics of omeprazole and its metabolites by gender and CYP2C19 genotype in Pakistani male and female subjects.
27010145 2016 Effect of cytochrome P450 2C19 polymorphisms on the Helicobacter pylori eradication rate following two-week triple therapy with pantoprazole or rabeprazole.
26970786 2016 Clinical Role of CYP2C19 Polymorphisms in Patients with Congenital Adrenal Hyperplasia Due to 21-hydroxylase Deficiency.
26916483 2016 Impact of CYP2C19 Metabolizer Status on Patients With ACS Treated With Prasugrel Versus Clopidogrel.
26822491 2016 Roles of CYP2C19 Gene Polymorphisms in Susceptibility to POAG and Individual Differences in Drug Treatment Response.
26817099 2015 [HIGH FREQUENCY OF CYP2C19 ULTRARAPID METABOLIZERS IN RUSSIAN PATIENTS WITH PEPTIC ULCER].
26722519 2015 Genetic polymorphisms and phenotypic analysis of drug-metabolizing enzyme CYP2C19 in a Li Chinese population.
26690534 2015 Characterization of drug-metabolizing enzymes CYP2C9, CYP2C19 polymorphisms in Tunisian, Kuwaiti and Bahraini populations.
26663068 2015 [Association of CYP2C19 gene polymorphisms with long-term recurrent risk of ischemic stroke among ethnic Han Chinese from Fujian].
26639454 2016 CYP2C19 drug-drug and drug-gene interactions in ED patients.
26456622 2016 Genetic markers in CYP2C19 and CYP2B6 for prediction of cyclophosphamide's 4-hydroxylation, efficacy and side effects in Chinese patients with systemic lupus erythematosus.
26343256 2015 The impact of CYP2C19 polymorphisms on citalopram metabolism in patients with major depressive disorder.
26338921 2016 Association between CYP2C19 Polymorphisms and Outcomes in Cerebral Endovascular Therapy.
26313485 2015 Escitalopram pharmacogenetics: CYP2C19 relationships with dosing and clinical outcomes in autism spectrum disorder.
26298540 2015 Cytochrome P450 genotypes are not associated with refractoriness to antipsychotic treatment.
26296572 2015 MicroRNA hsa-miR-29a-3p modulates CYP2C19 in human liver cells.
26272232 2015 Clopidogrel and CYP2C19: pharmacogenetic testing ready for clinical prime time?
26265611 2015 CYP2C19*2 and Other Allelic Variants Affecting Platelet Response to Clopidogrel Tested by Thrombelastography in Patients with Acute Coronary Syndrome.
26264906 2015 Association of CYP2C19, CYP3A5 and GPIIb/IIIa gene polymorphisms with Aspirin and Clopidogrel Resistance in a cohort of Indian patients with Coronary Artery Disease.
26244421 2015 Evaluation of predictive CYP2C19 genotyping assays relative to measured phenotype in a South African cohort.
26239729 2015 Gain-of-function single nucleotide variants of the CYP2C19 gene (CYP2C19*17) can identify subtherapeutic voriconazole concentrations in critically ill patients: a case series.
26223287 2016 Cytochrome P450 2C19 polymorphisms and valproic acid-induced weight gain.
26218263 2015 Implementation of Cell Samples as Controls in National Proficiency Testing for Clopidogrel Therapy-Related CYP2C19 Genotyping in China: A Novel Approach.
26153442 2015 In vitro functional analysis of 24 novel CYP2C19 variants recently found in the Chinese Han population.
26147597 2015 Cytochrome P450 CYP 2C19*2 Associated with Adverse 1-Year Cardiovascular Events in Patients with Acute Coronary Syndrome.
26126958 2015 Metabolism of (-)-cis- and (-)-trans-rose oxide by cytochrome P450 enzymes in human liver microsomes.
26117917 2015 [CLINICAL AND PHARMACOLOGICAL FACTORS INFLUENCING RESISTANCE TO CLOPIDOGREL IN PATIENTS WITH CARDIOVASCULAR DISEASES].
26062298 2015 A pharmacokinetic/pharmacodynamic analysis of a standard voriconazole regimen in different CYP2C19 genotypes by Monte Carlo simulation.
26021325 2015 The CYP2C19 Intron 2 Branch Point SNP is the Ancestral Polymorphism Contributing to the Poor Metabolizer Phenotype in Livers with CYP2C19*35 and CYP2C19*2 Alleles.
25999694 2015 A pharmacokinetic comparison of two voriconazole formulations and the effect of CYP2C19 polymorphism on their pharmacokinetic profiles.
25995169 2015 Development of population pharmacokinetics model of icotinib with non-linear absorption characters in healthy Chinese volunteers to assess the CYP2C19 polymorphism and food-intake effect.
25993709 2015 The impact of cytochrome P450 2C19 polymorphism on the occurrence of one-year in-stent restenosis in patients who underwent percutaneous coronary intervention: A case-match study.
25953735 2015 Influence of CYP2D6 and CYP2C19 genetic polymorphism on the pharmacokinetics of tolperisone in healthy volunteers.
25946232 Clopidogrel response variability: impact of genetic polymorphism and platelet biomarkers for predicting adverse outcomes poststenting.
25927305 2015 Independent and combined effects of environmental factors and CYP2C19 polymorphisms on the risk of esophageal squamous cell carcinoma in Fujian Province of China.
25921128 2015 CYP2C19 Genotype Could be a Predictive Factor for Aggressive Manifestations of Hepatocellular Carcinoma Related with Chronic Hepatitis B Infection in Thailand.
25897911 2015 CYP2C19 LOF alleles confer no risk for HTPR but higher risk for recurrent ischemic events in clopidogrel treated elderly ACS patients.
25877345 2015 CYP2C19 polymorphism and clinical outcomes among patients of different races treated with clopidogrel: A systematic review and meta-analysis.
25846871 2015 Genetic variability of CYP2C19 in a Mexican population: contribution to the knowledge of the inheritance pattern of CYP2C19*17 to develop the ultrarapid metabolizer phenotype.
25845826 2015 Prediction of in vivo clearance and associated variability of CYP2C19 substrates by genotypes in populations utilizing a pharmacogenetics-based mechanistic model.
25844821 2015 Lansoprazole Is Associated with Worsening Asthma Control in Children with the CYP2C19 Poor Metabolizer Phenotype.
25838219 2015 Intraprocedural thrombotic event during coronary intervention depends on CYP2C19 genotype and is a predictor of future clinical event.
25823779 2015 Implementation and evaluation of a CYP2C19 genotype-guided antiplatelet therapy algorithm in high-risk coronary artery disease patients.
25803758 2016 Pharmacogenetic Testing for Analgesic Adverse Effects: Pediatric Case Series.
25730082 2015 Diversity of platelet function and genetic polymorphism in clopidogrel-treated Chinese patients.
25712182 2015 Effect of clinical factors and gene polymorphism of CYP2C19*2, *17 and CYP4F2*3 on early stent thrombosis.
25686762 2015 Clinical validity: Combinatorial pharmacogenomics predicts antidepressant responses and healthcare utilizations better than single gene phenotypes.
25652102 2015 CYP2C19*17 affects R-warfarin plasma clearance and warfarin INR/dose ratio in patients on stable warfarin maintenance therapy.
25605208 2014 Effects of the CYP2C19 genetic polymorphism on gastritis, peptic ulcer disease, peptic ulcer bleeding and gastric cancer.
25600201 2015 In Vitro Evaluation of Reversible and Time-Dependent Inhibitory Effects of Kalanchoe crenata on CYP2C19 and CYP3A4 Activities.
25552922 2015 Combination analysis in genetic polymorphisms of drug-metabolizing enzymes CYP1A2, CYP2C9, CYP2C19, CYP2D6 and CYP3A5 in the Japanese population.
25542807 2015 Genetic polymorphisms of CYP2C19 2 and ABCB1 C3435T affect the pharmacokinetic and pharmacodynamic responses to clopidogrel in 401 patients with acute coronary syndrome.
25529343 2015 CYP2C19 genotype and early ischemic lesion recurrence in stroke patients treated with clopidogrel.
25518511 2014 [Factors influencing platelet aggregation in patients with acute coronary syndrome].
25518510 2014 [Effect of original and generic clopidogrel on prognosis in relation to different gene polymorphisms].
25511576 2015 Effect of high-dose clopidogrel according to CYP2C19*2 genotype in patients undergoing percutaneous coronary intervention- a systematic review and meta-analysis.
25498969 2014 Hydroxylation index of omeprazole in relation to CYP2C19 polymorphism and sex in a healthy Iranian population.
25495411 2014 Evaluation of the relationship between polymorphisms in CYP2C19 and the pharmacokinetics of omeprazole, pantoprazole and rabeprazole.
25495406 2014 Polymorphic expression of CYP2C19 and CYP2D6 in the developing and adult human brain causing variability in cognition, risk for depression and suicide: the search for the endogenous substrates.
25466287 2014 Recurrent CYP2C19 deletion allele is associated with triple-negative breast cancer.
25465810 2015 Impact of cytochrome P450 2C19 loss-of-function polymorphism on intra-stent thrombi and lesion outcome after everolimus-eluting stent implantation compared to that after first-generation drug-eluting stent implantation.
25463363 2015 Joint effects of CYP2C19*2 and smoking status on clopidogrel responsiveness in patients with acute coronary syndrome.
25428337 2014 A randomized controlled trial of adjunctive Bunchang Naoxintong Capsule (???????) versus maintenance dose clopidogrel in patients with CYP2C19*2 polymorphism.
25403437 2015 CYP2C19 polymorphism increases the risk of endometriosis.
25381554 2014 Analysis of the CYP2C19 genetic polymorphism in Han and Uyghur patients with cardiovascular and cerebrovascular diseases in the Kashi area of Xinjiang.
25339025 2014 Association of CYP2C19 polymorphisms with survival of breast cancer patients using tamoxifen: results of a meta- analysis.
25323806 2015 Effect of CYP2C19 polymorphisms on the clinical outcome of low-dose clobazam therapy in Japanese patients with epilepsy.
25303292 2014 Pharmacogenomic testing: the case for CYP2C19 proton pump inhibitor gene-drug pairs.
25286744 2015 The effect of induction of CYP3A4 by St John's wort on ambrisentan plasma pharmacokinetics in volunteers of known CYP2C19 genotype.
25264752 2015 Gender differences in impact of CYP2C19 polymorphism on development of coronary artery disease.
25258374 2014 CYP2C19 genotype has a greater effect on adverse cardiovascular outcomes following percutaneous coronary intervention and in Asian populations treated with clopidogrel: a meta-analysis.
25245581 2015 Influence of CYP2D6 and CYP2C19 genotypes on venlafaxine metabolic ratios and stereoselective metabolism in forensic autopsy cases.
25241292 2014 Gender and functional CYP2C and NAT2 polymorphisms determine the metabolic profile of metamizole.
25207801 2015 Variant recurrent risk among stroke patients with different CYP2C19 phenotypes and treated with clopidogrel.
25201060 2014 Chronic kidney disease status modifies the association of CYP2C19 polymorphism in predicting clinical outcomes following coronary stent implantation.
25156215 2015 Comparison of the effect of CYP2C19 polymorphism on clinical outcome between acute coronary syndrome and stable angina.
25155930 2014 Voriconazole and atazanavir: a CYP2C19-dependent manageable drug-drug interaction.
25154506 2014 Impact of cytochrome P450 2C19 polymorphisms on citalopram/escitalopram exposure: a systematic review and meta-analysis.
25141895 2014 Analysis of compound heterozygous CYP2C19 genotypes to determine cis and trans configurations.
25121365 Association of polymorphisms of CYP2C9, CYP2C19, and ABCB1, and activity of P-glycoprotein with response to anti-epileptic drugs.
25113522 2015 A combined high CYP2D6-CYP2C19 metabolic capacity is associated with the severity of suicide attempt as measured by objective circumstances.
25109411 2014 Effects of genetic polymorphisms of CYP2C19*2/*3 and MDR1 C3435T on the pharmacokinetics of lansoprazole in healthy Chinese subjects.
25106522 2014 Distribution of ABCB1, CYP3A5, CYP2C19, and P2RY12 gene polymorphisms in a Mexican Mestizos population.
25084200 2014 Voriconazole plasma concentrations in immunocompromised pediatric patients vary by CYP2C19 diplotypes.
25077812 2015 Metabolism of agrochemicals and related environmental chemicals based on cytochrome P450s in mammals and plants.
25073096 2014 Evaluation of genipin on human cytochrome P450 isoenzymes and P-glycoprotein in vitro.
25068772 2015 Incidence of drug interaction when using proton pump inhibitor and warfarin according to cytochrome P450 2C19 (CYP2C19) genotype in Japanese.
25061471 2014 Inhibition of Human Cytochrome P450 Enzymes by Allergen Removed Rhus verniciflua Stoke Standardized Extract and Constituents.
25060201 2014 Role of genetic factors on the effect of additional loading doses and two maintenance doses used to overcome clopidogrel hyporesponsiveness.
25044100 2014 Clopidogrel, CYP2C19 and proton pump inhibitors: what we know and what it means.
25043069 2014 Comparison of loading with maintenance dose of clopidogrel on platelet reactivity in Chinese with different CYP2C19 genotypes prior to percutaneous coronary intervention.
25030528 2014 Association between genetic polymorphisms of cytochrome P450 2C19 and the risk of cerebral ischemic stroke in Chinese.
25008027 2014 The effect of CYP2C19 gene polymorphisms on the pharmacokinetics and pharmacodynamics of prasugrel 5-mg, prasugrel 10-mg and clopidogrel 75-mg in patients with coronary artery disease.
25001882 2015 Functional characterization of 21 CYP2C19 allelic variants for clopidogrel 2-oxidation.
25001880 2015 Clinical outcomes associated with proton pump inhibitor use among clopidogrel-treated patients within CYP2C19 genotype groups following acute myocardial infarction.
24996381 2014 Gene polymorphism of cytochrome P450 2C19*2 and clopidogrel resistance reflected by platelet function assays: a meta-analysis.
24996380 2014 Comparison of acid inhibition with standard dosages of proton pump inhibitors in relation to CYP2C19 genotype in Japanese.
24956251 2014 Assessment of CYP450 genetic variability effect on methadone dose and tolerance.
24956245 2014 Clopidogrel dose adjustment after outpatient screening for CYP2C19 variant alleles: a pilot study.
24952855 2014 CYP2C19 genotype-guided antiplatelet therapy in ST-segment elevation myocardial infarction patients-Rationale and design of the Patient Outcome after primary PCI (POPular) Genetics study.
24946154 2015 A systematic review and critical assessment of 11 discordant meta-analyses on reduced-function CYP2C19 genotype and risk of adverse clinical outcomes in clopidogrel users.
24945780 2014 The influence of the CYP2C19*10 allele on clopidogrel activation and CYP2C19*2 genotyping.
24906606 2014 Individuals having variant genotypes of cytochrome P450 2C19 are at increased risk of developing primary liver cancer in Han populations, without infection with the hepatitis virus.
24877854 2014 Patients carrying CYP2C19 loss of function alleles have a reduced response to clopidogrel therapy and a greater risk of in-stent restenosis after endovascular treatment of lower extremity peripheral arterial disease.
24858822 2014 Impact of age on serum concentrations of venlafaxine and escitalopram in different CYP2D6 and CYP2C19 genotype subgroups.
24821368 2014 Impact of CYP2C19 polymorphism on clinical outcome following coronary stenting is more important in non-diabetic than diabetic patients.
24819914 2015 Effect of CYP2C19 polymorphisms on stiripentol administration in Japanese cases of Dravet syndrome.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24798722 2014 How common are drug and gene interactions? Prevalence in a sample of 1143 patients with CYP2C9, CYP2C19 and CYP2D6 genotyping.
24796765 2014 Common variants in the CYP2C19 gene are associated with susceptibility to endometriosis.
24782221 2014 The influence of genetic polymorphism of Cyp2c19 isoenzyme on the pharmacokinetics of clopidogrel and its metabolites in patients with cardiovascular diseases.
24781308 2015 Lack of association between peri-procedural myocardial damage and CYP2C19 gene variant in elective percutaneous coronary intervention.
24762860 2014 Cytochrome p450 gene variants, race, and mortality among clopidogrel-treated patients after acute myocardial infarction.
24761684 2014 Modified sequential Helicobacter pylori eradication therapy using high dose omeprazole and amoxicillin in the initial phase in the extensive metaboliser Turkish patients for CYP2C19 polymorphism is ineffective.
24723553 2014 ?2A-Adrenergic receptor polymorphism potentiates platelet reactivity in patients with stable coronary artery disease carrying the cytochrome P450 2C19*2 genetic variant.
24710841 2014 Effectiveness of clopidogrel dose escalation to normalize active metabolite exposure and antiplatelet effects in CYP2C19 poor metabolizers.
24690327 2014 Inactive alleles of cytochrome P450 2C19 may be positively selected in human evolution.
24617511 2015 Evaluation of the INNOVANCE PFA P2Y assay and its association with CYP2C19 genotypes.
24608794 2014 CYP2C19 polymorphisms and coronary heart disease risk factors synergistically impact clopidogrel response variety after percutaneous coronary intervention.
24599773 2014 Factors affecting first-line triple therapy of Helicobacter pylori including CYP2C19 genotype and antibiotic resistance.
24589079 2014 Association between the microarray-based CYP2C19 genotyping assay and the platelet function test in cardiovascular patients receiving clopidogrel.
24581091 CYP 450 2C19 polymorphisms in Indian patients with coronary artery disease.
24576527 2014 Prevalence of CYP2C19 variant alleles and pharmacodynamic variability of aspirin and clopidogrel in Native Americans.
24535487 2014 The effects of CES1A2 A(-816)C and CYP2C19 loss-of-function polymorphisms on clopidogrel response variability among Chinese patients with coronary heart disease.
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
24527758 2014 Genetic variations in the xenobiotic-metabolizing enzymes CYP1A1, CYP1A2, CYP2C9, CYP2C19 and susceptibility to colorectal cancer among Turkish people.
24519754 2014 CYP2C19 genotype-phenotype discordance in patients with multiple myeloma leads to an acquired loss of drug-metabolising activity.
24510350 2014 Interaction between smoking and CYP2C19*3 polymorphism increased risk of lung cancer in a Chinese population.
24504666 2014 Positive clinical response to clopidogrel is independent of paraoxonase 1 Q192R and CYP2C19 genetic variants.
24501942 2013 [The influence of genetic factors on the effectiveness of eradication therapy of Helicobacter pylori infection in children].
24492587 2014 Effect of cytochrome P450 2C19 and 2C9 amino acid residues 72 and 241 on metabolism of tricyclic antidepressant drugs.
24488700 2014 Neither cytochrome P450 family genes nor neuroendocrine factors could independently predict the SSRIs treatment in the Chinese Han population.
24443221 2014 Characterization of CYP1A2, CYP2C19, CYP3A4 and CYP3A5 polymorphisms in South Brazilians.
24440142 2014 Impact of CYP2C19 polymorphism and proton pump inhibitors on platelet reactivity to clopidogrel and clinical outcomes following stent implantation.
24430292 2014 Genetic polymorphisms of CYP2C8, CYP2C9 and CYP2C19 in Ecuadorian Mestizo and Spaniard populations: a comparative study.
24403552 2014 Voriconazole metabolism, toxicity, and the effect of cytochrome P450 2C19 genotype.
24402637 2014 Clopidogrel metaboliser status based on point-of-care CYP2C19 genetic testing in patients with coronary artery disease.
24346747 2014 Effects of CYP2C19 genetic polymorphisms on atomoxetine pharmacokinetics.
24345815 2014 Effects of CYP2C19 and P450 oxidoreductase polymorphisms on the population pharmacokinetics of clobazam and N-desmethylclobazam in japanese patients with epilepsy.
24340040 2013 Polymorphic cytochrome P450 enzymes (CYPs) and their role in personalized therapy.
24338437 2014 The effect of genetic polymorphisms of cytochrome P450 CYP2C9, CYP2C19, and CYP2D6 on drug-resistant epilepsy in Turkish children.
24330577 2014 The association between CYP2C19 genotype and of in-stent restenosis among patients with vertebral artery stent treatment.
24315317 2014 Investigation of CYP2C19 allele and genotype frequencies in Iranian population using experimental and computational approaches.
24279856 2013 Cost-effectiveness of using CYP2C19 genotype to guide selection of clopidogrel or ticagrelor in Australia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24257813 2014 Genetic differences in cytochrome P450 enzymes and antidepressant treatment response.
24222221 2013 Genetic contribution of CYP2C9, CYP2C19, and APOE variants in acenocoumarol response.
24214141 2014 The effect of CYP2C19 genotype on the time course of platelet aggregation inhibition after clopidogrel administration.
24169346 2013 CYP2C19 genotype-based phase I studies of a c-Met inhibitor tivantinib in combination with erlotinib, in advanced/metastatic non-small cell lung cancer.
24151801 2013 Towards the implementation of CYP2D6 and CYP2C19 genotypes in clinical practice: update and report from a pharmacogenetic service clinic.
24113215 2013 Sex differences in the effect of cytochrome P450 2C19 polymorphisms on the risk of diabetic retinopathy: a retrospective longitudinal study in Japanese patients with type 2 diabetes.
24089073 2014 Association between inherited CYP2D6/2C19 phenotypes and anticholinergic measures in elderly patients using anticholinergic drugs.
24088578 2014 Impact of CYP2C19 polymorphism on platelet function tests and coagulation and inflammatory biomarkers in patients undergoing percutaneous coronary intervention.
24088005 2013 [Informativeness of genetic factors for optimization of personalized therapy with clopidogrel].
24080325 2013 Cytochrome CYP2C19 polymorphism and risk of adverse clinical events in clopidogrel-treated patients: a meta-analysis based on 23,035 subjects.
24080149 2013 Paraoxonase-1 activity affects the clopidogrel response in CYP2C19 loss-of-function carriers.
24022708 2014 A correlative study of polymorphisms of CYP2C19 and MDR1 C3435T with the pharmacokinetic profiles of lansoprazole and its main metabolites following single oral administration in healthy adult Chinese subjects.
24019397 2013 CYP2C19 poor metabolizer is associated with clinical outcome of clopidogrel therapy in acute myocardial infarction but not stable angina.
24016178 2013 Functional genetic polymorphisms in CYP2C19 gene in relation to cardiac side effects and treatment dose in a methadone maintenance cohort.
24015291 2013 Poor metabolizers at the cytochrome P450 2C19 loci is at increased risk of developing cancer in Asian populations.
23981380 2013 Cytochrome P450 2C19*2 polymorphism in patients with stable coronary heart disease and risk for secondary cardiovascular disease events: results of a long-term follow-up study in routine clinical care.
23959307 2013 CYP2J2 and CYP2C19 are the major enzymes responsible for metabolism of albendazole and fenbendazole in human liver microsomes and recombinant P450 assay systems.
23951298 2013 Prognostic significance of ESR1 amplification and ESR1 PvuII, CYP2C19*2, UGT2B15*2 polymorphisms in breast cancer patients.
23941071 2013 Association of genetic polymorphisms with warfarin dose requirements in Chinese patients.
23895809 2013 Racial disparity with on-treatment platelet reactivity in patients undergoing percutaneous coronary intervention.
23886632 2013 Platelet reactivity in the early and late phases of acute coronary syndromes according to cytochrome P450 2C19 phenotypes.
23877834 2014 Decreased hippocampal volume and increased anxiety in a transgenic mouse model expressing the human CYP2C19 gene.
23874401 2013 Functional polymorphisms in the CYP2C19 gene contribute to digestive system cancer risk: evidence from 11,042 subjects.
23872648 2013 The impact of gene polymorphism and high on-treatment platelet reactivity on clinical follow-up: outcomes in patients with acute coronary syndrome after drug-eluting stent implantation.
23850318 2013 Personalized antiplatelet therapy according to CYP2C19 genotype after percutaneous coronary intervention: a randomized control trial.
23850044 2014 [Relevance of CYP2C19 2 regarding platelet reactivity in patients with acute coronary syndrome treated with clopidogrel].
23834474 2014 Expansion of a PBPK model to predict disposition in pregnant women of drugs cleared via multiple CYP enzymes, including CYP2B6, CYP2C9 and CYP2C19.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23785064 2013 Stereoselective inhibition of CYP2C19 and CYP3A4 by fluoxetine and its metabolite: implications for risk assessment of multiple time-dependent inhibitor systems.
23755828 2013 Genetic variants associated with warfarin dose in African-American individuals: a genome-wide association study.
23754447 2013 Quantitative assessment of the influence of cytochrome P450 2C19 gene polymorphisms and digestive tract cancer risk.
23736997 2013 CYP2C19 2 predicts substantial tamoxifen benefit in postmenopausal breast cancer patients randomized between adjuvant tamoxifen and no systemic treatment.
23700873 Impact of clopidogrel response on the clinical evolution in patients with acute coronary syndromes.
23646118 2013 Effects of CYP2C19 loss-of-function variants on the eradication of H. pylori infection in patients treated with proton pump inhibitor-based triple therapy regimens: a meta-analysis of randomized clinical trials.
23645039 2013 High prevalence of CYP2C19*2 allele in Roma samples: study on Roma and Hungarian population samples with review of the literature.
23640828 2013 CYP2C19 polymorphisms and antiplatelet effects of clopidogrel in acute ischemic stroke in China.
23629159 2014 Efavirenz-mediated induction of omeprazole metabolism is CYP2C19 genotype dependent.
23623526 2013 Association of CYP2C19 polymorphisms and lansoprazole-associated respiratory adverse effects in children.
23618682 2013 Suboptimal response to clopidogrel: a genetic risk factor for recurrent ischaemic stroke.
23607088 2013 Feasibility of a microarray-based point-of-care CYP2C19 genotyping test for predicting clopidogrel on-treatment platelet reactivity.
23588332 2013 Correlation of CYP2C19 phenotype with voriconazole plasma concentration in children.
23556336 2013 CYP2C19 polymorphism and antiplatelet effects of clopidogrel in Chinese stroke patients.
23555019 2013 CYP2C19 phenotype, stent thrombosis, myocardial infarction, and mortality in patients with coronary stent placement in a Chinese population.
23551241 2013 Phenobarbital-induced severe cutaneous adverse drug reactions are associated with CYP2C19*2 in Thai children.
23517020 2013 Influence of CYP2C19*2 and *3 loss-of-function alleles on the pharmacodynamic effects of standard- and high-dose clopidogrel in East Asians undergoing percutaneous coronary intervention: the results of the ACCEL-DOUBLE-2N3 study.
23506580 2013 Effects of coexisting polymorphisms of CYP2C19 and P2Y12 on clopidogrel responsiveness and clinical outcome in patients with acute coronary syndromes undergoing stent-based coronary intervention.
23474843 2013 CYP2C19 genetic polymorphism, rabeprazole and esomeprazole have no effect on the antiplatelet action of clopidogrel.
23470885 2013 Relationship between CYP2C19 loss-of-function polymorphism and platelet reactivities with clopidogrel treatment in Japanese patients undergoing coronary stent implantation.
23469989 2013 Lack of association between genetic polymorphisms of CYP3A4, CYP2C9 and CYP2C19 and antituberculosis drug-induced liver injury in a community-based Chinese population.
23429358 2013 Relationship of CYP2C19*2 and CYP2C19*3 gene polymorphism with clopidogrel response variability and recurrent cardiovascular events in Chinese patients undergoing percutaneous coronary intervention.
23413279 2013 The effect of CYP2C19 polymorphism on the safety, tolerability, and pharmacokinetics of tivantinib (ARQ 197): results from a phase I trial in advanced solid tumors.
23412869 2013 Regulatory polymorphisms in CYP2C19 affecting hepatic expression.
23402725 2013 The impact of CYP2C19 genotype on cardiovascular events and platelet reactivity in patients with coronary artery disease receiving clopidogrel.
23364775 2013 Cardiovascular risk among patients on clopidogrel anti-platelet therapy after placement of drug-eluting stents is modified by genetic variants in both the CYP2C19 and ABCB1 genes.
23340030 2013 Effect of CYP2C19*2 and *17 genetic variants on platelet response to clopidogrel and prasugrel maintenance dose and relation to bleeding complications.
23337798 2013 The CYP2C19 genotype does not impact the long-term prognosis of patients with coronary artery disease.
23267857 2013 CYP2C19*17 gain-of-function polymorphism is associated with peptic ulcer disease.
23257377 2012 CYP2C19*2 and *17 alleles have a significant impact on platelet response and bleeding risk in patients treated with prasugrel after acute coronary syndrome.
23193974 2013 The action of cytochrome b(5) on CYP2E1 and CYP2C19 activities requires anionic residues D58 and D65.
23179471 2013 Pharmacokinetics and bioavailability comparison of generic and branded citalopram 20 mg tablets: an open-label, randomized-sequence, two-period crossover study in healthy Chinese CYP2C19 extensive metabolizers.
23175667 2013 Increased hospital stay and allograft dysfunction in renal transplant recipients with Cyp2c19 AA variant in SNP rs4244285.
23148634 2012 Genetic polymorphisms and novel allelic variants of CYP2C19 in the Chinese Han population.
23118231 2012 Structural characterization of human cytochrome P450 2C19: active site differences between P450s 2C8, 2C9, and 2C19.
23081704 2013 The impact of Cytochrome P450 CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes on suicide attempt and suicide risk-a European multicentre study on treatment-resistant major depressive disorder.
23074110 2012 Association of CYP2C19*2 and *3 genetic variants with essential hypertension in Koreans.
23016454 2012 CYP2C19 681G > A polymorphism and pharmacokinetics of clopidogrel in Chinese healthy volunteers.
23001453 2013 Influence of CYP2C19 loss-of-function variants on the antiplatelet effects and cardiovascular events in clopidogrel-treated Chinese patients undergoing percutaneous coronary intervention.
22984423 2012 Interaction between alcohol consumption and CYP 2C19 gene polymorphism in relation to oesophageal squamous cell carcinoma.
22974728 2013 Besides CYP2C19, PON1 genetic variant influences post-clopidogrel platelet reactivity in Chinese patients.
22971905 2012 Association of CYP2C19 genotype with periprocedural myocardial infarction after uneventful stent implantation in Chinese patients receiving clopidogrel pretreatment.
22955794 2013 Genetic polymorphisms of CYP2C19 influences the response to clopidogrel in ischemic heart disease patients in the South Indian Tamilian population.
22940005 2013 Value of platelet pharmacogenetics in common clinical practice of patients with ST-segment elevation myocardial infarction.
22929815 CYP2C19*2/ABCB1-C3435T polymorphism and risk of cardiovascular events in coronary artery disease patients on clopidogrel: is clinical testing helpful?
22913530 2012 Distribution of CYP2D6 and CYP2C19 polymorphisms associated with poor metabolizer phenotype in five Amerindian groups and western Mestizos from Mexico.
22875511 2012 [Impact of proton pump inhibitor omeprazole on the antiplatelet effect of clopidogrel in individuals with various CYP2C19*2 genotypes].
22875498 2012 [Prevalence of CYP2C19 polymorphisms involved in clopidogrel metabolism in Fujian Han population].
22873740 2012 Individualized therapy for gastroesophageal reflux disease: potential impact of pharmacogenetic testing based on CYP2C19.
22855348 2013 Responsiveness to low-dose warfarin associated with genetic variants of VKORC1, CYP2C9, CYP2C19, and CYP4F2 in an Indonesian population.
22839512 2012 [CYP2C19 gene polymorphism in patients with myocardial infarction who use clopidogrel].
22785462 2012 Effect of cytochrome P450 2C19 polymorphism on target lesion outcome after drug-eluting stent implantation in japanese patients receiving clopidogrel.
22784880 2012 Polymorphisms in cytochrome P450 2C19 enzyme and cessation of leflunomide in patients with rheumatoid arthritis.
22747643 2013 CYP2C19 genetic polymorphism in Saudi Arabians.
22704413 2012 Relationship between cytochrome P450 2C19*17 genotype distribution, platelet aggregation and bleeding risk in patients with blood stasis syndrome of coronary artery disease treated with clopidogrel.
22648560 2012 Evaluation of six proton pump inhibitors as inhibitors of various human cytochromes P450: focus on cytochrome P450 2C19.
22641027 2013 Neurological toxicity after phenytoin infusion in a pediatric patient with epilepsy: influence of CYP2C9, CYP2C19 and ABCB1 genetic polymorphisms.
22624833 2012 Influence of genetic polymorphisms on the effect of high- and standard-dose clopidogrel after percutaneous coronary intervention: the GIFT (Genotype Information and Functional Testing) study.
22612904 2012 Pharmacodynamic effect of clopidogrel therapy and switching to cilostazol in patients with the CYP2C19 loss-of-function allele (ACCEL-SWITCH) study.
22591668 2012 Meta-analysis of cytochrome P450 2C19 polymorphism and risk of adverse clinical outcomes among coronary artery disease patients of different ethnic groups treated with clopidogrel.
22589111 2012 Rapid testing of clopidogrel resistance by genotyping of CYP2C19 and CYP2C9 polymorphisms using denaturing on-chip capillary electrophoresis.
22585284 2012 Effect of the CYP2C19 genotype on the pharmacokinetics of icotinib in healthy male volunteers.
22552318 2012 Systematic review and meta-analysis of the association between cytochrome P450 2C19 genotype and bleeding.
22491019 2013 Multi-ethnic distribution of clinically relevant CYP2C genotypes and haplotypes.
22476388 2012 Linkage disequilibrium between the CYP2C19*17 allele and other clinically important CYP2C allelic variants in a healthy Scandinavian population.
22469723 2012 Western blotting analysis for quantitative detection of CYP2C19 expression in liver tissues in the setting of living donor liver transplantation.
22450429 2012 The relationship between CYP2C19 polymorphisms and ischaemic and bleeding outcomes in stable outpatients: the CHARISMA genetics study.
22425806 2012 The effect of the CYP 2C19*2 polymorphism on stroke care.
22418828 2012 CYP2C19 polymorphism affects single-dose pharmacokinetics of oral pantoprazole in healthy volunteers.
22377481 2012 CYP2C19*2 and prognosis after an acute coronary syndrome: Insights from a Portuguese center.
22374717 2012 Clarifying the importance of CYP2C19 and PON1 in the mechanism of clopidogrel bioactivation and in vivo antiplatelet response.
22324425 2012 A comparison of the acid-inhibitory effects of esomeprazole and rabeprazole in relation to pharmacokinetics and CYP2C19 polymorphism.
22318618 2012 Induction of CYP2C19 and CYP3A activity following repeated administration of efavirenz in healthy volunteers.
22304323 2011 [The effectiveness of Ticagrelor does not depend on CYP2C19 gene polymorphism and ABCB1: results of a genetic analysis of the study PLATO].
22281205 2012 Effect of CYP2B6*6 and CYP2C19*2 genotype on chlorpyrifos metabolism.
22228204 2012 The influence of CYP2C19*2 and *17 on on-treatment platelet reactivity and bleeding events in patients undergoing elective coronary stenting.
22183943 2011 Interaction between CYP 2C19*3 polymorphism and smoking in relation to laryngeal carcinoma in the Chinese Han population.
22180071 2011 Association of CYP2C19*3 gene polymorphism with breast cancer in Chinese women.
22154242 2012 Influence of cytochrome 2C19 allelic variants on on-treatment platelet reactivity evaluated by five different platelet function tests.
22123356 2012 The gain-of-function variant allele CYP2C19*17: a double-edged sword between thrombosis and bleeding in clopidogrel-treated patients.
22122271 2012 A case report of voriconazole therapy failure in a homozygous ultrarapid CYP2C19*17/*17 patient comedicated with carbamazepine.
22118006 2011 Relationship between cytochrome P450 2C19*2 polymorphism and stent thrombosis following percutaneous coronary intervention in Chinese patients receiving clopidogrel.
22116003 2012 Influence of CYP2C19 polymorphisms in platelet reactivity and prognosis in an unselected population of non ST elevation acute coronary syndrome.
22088240 2011 [Impact of cytochrome P450 2C19 polymorphisms on outcome of cardiovascular events in clopidogrel-treated Chinese patients after percutaneous coronary intervention].
22071359 2012 Association between cytochrome P450 2C19 polymorphism and clinical outcomes in Chinese patients with coronary artery disease.
22070512 2012 Ilaprazole for the treatment of duodenal ulcer: a randomized, double-blind and controlled phase III trial.
22045970 2011 Effect of CYP2C19*2 and *3 loss-of-function alleles on platelet reactivity and adverse clinical events in East Asian acute myocardial infarction survivors treated with clopidogrel and aspirin.
22030270 2012 CYP2C19 gene variants cut-off levels for on-clopidogrel platelet aggregation.
22028352 2011 Clinical, angiographic, and genetic factors associated with early coronary stent thrombosis.
22007612 2012 Interaction analysis between genetic polymorphisms and pharmacodynamic effect in patients treated with adjunctive cilostazol to dual antiplatelet therapy: results of the ACCEL-TRIPLE (Accelerated Platelet Inhibition by Triple Antiplatelet Therapy According to Gene Polymorphism) study.
21977947 2012 Distribution of CYP2C polymorphisms in an Amerindian population of Brazil.
21972404 2011 CYP2C19 but not PON1 genetic variants influence clopidogrel pharmacokinetics, pharmacodynamics, and clinical efficacy in post-myocardial infarction patients.
21971440 2012 Cytochrome P450 polymorphism and postoperative cognitive dysfunction.
21916910 2012 Distribution of CYP2C19*17 allele and genotypes in an Indian population.
21913948 2012 Differences in genotype and allele frequency distributions of polymorphic drug metabolizing enzymes CYP2C19 and CYP2D6 in mainland Chinese Mongolian, Hui and Han populations.
21913914 2012 Homogenous phenomenon of graft liver CYP2C19 genotypes after living donor liver transplantation.
21887904 2011 CYP2C19 polymorphism as a predictor of personalized therapy in South Indian population.
21862109 2011 Determination of cut-off levels for on-clopidogrel platelet aggregation based on functional CYP2C19 gene variants in patients undergoing elective percutaneous coronary intervention.
21861665 2011 Novel drug metabolism indices for pharmacogenetic functional status based on combinatory genotyping of CYP2C9, CYP2C19 and CYP2D6 genes.
21831410 2012 CYP2C19*2 and other genetic variants affecting platelet response to clopidogrel in patients undergoing percutaneous coronary intervention.
21826689 2011 Pilot study for the characterization of pharmacogenetically relevant CYP2D6, CYP2C19 and ABCB1 gene polymorphisms in the Hungarian population.
21806387 2011 Impact of genetic variants on post-clopidogrel platelet reactivity in patients after elective percutaneous coronary intervention.
21803320 2011 Usefulness of high clopidogrel maintenance dose according to CYP2C19 genotypes in clopidogrel low responders undergoing coronary stenting for non ST elevation acute coronary syndrome.
21798861 2011 Genetic variation in the CYP2C monooxygenase enzyme subfamily shows no association with longevity in a German population.
21795468 2011 The proton pump inhibitor, omeprazole, but not lansoprazole or pantoprazole, is a metabolism-dependent inhibitor of CYP2C19: implications for coadministration with clopidogrel.
21794898 2011 Association of genetic variants in CYP2C19 and adverse clinical outcomes after treatment with clopidogrel: an updated meta-analysis.
21786436 2011 Cytochrome P450 2C19 polymorphism is associated with reduced clopidogrel response in cerebrovascular disease.
21778720 2011 The value of combining CYP2C19*2 polymorphism with classic risk factors in prediction of clinical prognosis in acute coronary syndrome patients.
21777277 2012 CYP2C19 genotypes determine the efficacy of on-demand therapy of pantoprazole for reflux esophagitis as Los-Angeles grades C and D.
21766908 2011 Development of cocaine-induced interstitial lung damage in two CYP2C and VKORC1 variant allele carriers.
21741706 2012 Correlation of CYP2B6, CYP2C19, ABCC4 and SOD2 genotype with outcomes in allogeneic blood and marrow transplant patients.
21692828 2012 The population pharmacokinetics of R- and S-warfarin: effect of genetic and clinical factors.
21689142 2012 Pharmacokinetics and pharmacodynamics following maintenance doses of prasugrel and clopidogrel in Chinese carriers of CYP2C19 variants.
21628721 2011 Variability in on-treatment platelet reactivity explained by CYP2C19*2 genotype is modest in clopidogrel pretreated patients undergoing coronary stenting.
21627593 2011 [Factors determining clinical effectiveness of clopidogrel and prognosis of patients with stable ischemic heart disease].
21527445 2011 No association of paraoxonase-1 Q192R genotypes with platelet response to clopidogrel and risk of stent thrombosis after coronary stenting.
21511219 2011 Prasugrel overcomes high on-clopidogrel platelet reactivity post-stenting more effectively than high-dose (150-mg) clopidogrel: the importance of CYP2C19*2 genotyping.
21511217 2011 Platelet inhibition by adjunctive cilostazol versus high maintenance-dose clopidogrel in patients with acute myocardial infarction according to cytochrome P450 2C19 genotype.
21507170 2011 Voriconazole toxicity related to polymorphisms in CYP2C19.
21497341 2011 High-density fine-mapping of a chromosome 10q26 linkage peak suggests association between endometriosis and variants close to CYP2C19.
21473286 2011 A fully integrated and automated detection system for single nucleotide polymorphisms of UGT1A1 and CYP2C19.
21383338 2012 Effect of CYP2C19 polymorphism on the pharmacokinetics of voriconazole after single and multiple doses in healthy volunteers.
21380557 2011 Prevalence of CYP2C19 polymorphisms in the Lebanese population.
21358751 2012 Identification of CYP2C19*4B: pharmacogenetic implications for drug metabolism including clopidogrel responsiveness.
21332417 2011 Association of genetic polymorphisms of CYP 2C19 with hypertension in a Chinese Han population.
21315147 High-resolution melting curve analysis to establish CYP2C19?2 single nucleotide polymorphism: Comparison with hydrolysis SNP analysis.
21302482 2010 [Relationships of blood stasis syndrome, CYP2C19 gene polymorphism with clopidogrel resistance and post-PCI prognosis].
21299635 Value of preemptive CYP2C19 genotyping in allogeneic stem cell transplant patients considered for pentamidine administration.
21247447 2011 CYP2C19 and ABCB1 gene polymorphisms are differently distributed according to ethnicity in the Brazilian general population.
21237322 2010 [Impact of genetic polymorphisms in the clinical response of oral inhibitors of the platelet P2Y12 adenosine diphosphate (ADP) receptor].
21215696 2011 Clopidogrel Resistance: case reports of CYP2C19 gene variants in suspected coronary stent thrombosis.
21212520 2011 Individual metabolic capacity evaluation of cytochrome P450 2C19 by protein and activity in the small intestinal mucosa of Japanese pancreatoduodenectomy patients.
21192344 2011 CYP2C19 variation and citalopram response.
21173785 2012 Global pharmacogenomics: Impact of population diversity on the distribution of polymorphisms in the CYP2C cluster among Brazilians.
21160212 2011 CYP2C19 gene polymorphism may be a risk factor for bronchial asthma.
21152987 2011 Functional characterization of promoter region polymorphisms of human CYP2C19 gene.
21132257 2011 Personalized treatment in the eradication therapy for Helicobacter pylori.
21108610 2010 Analysis of CYP2C9*2, CYP2C19*2, and CYP2D6*4 polymorphisms in patients with type 2 diabetes mellitus.
21108329 2010 Allelic variations in CYP2B6 and CYP2C19 and survival of patients receiving cyclophosphamide prior to myeloablative hematopoietic stem cell transplantation.
21099121 2011 Impact of cytochrome P450 2C19*2 polymorphism on intra-stent thrombus after drug-eluting stent implantation in Japanese patients receiving clopidogrel.
21079055 2010 First analysis of the relation between CYP2C19 genotype and pharmacodynamics in patients treated with ticagrelor versus clopidogrel: the ONSET/OFFSET and RESPOND genotype studies.
21075428 2011 The cytochrome 2C19*2 and *3 alleles attenuate response to clopidogrel similarly in East Asian patients undergoing elective percutaneous coronary intervention.
21071160 2011 Analysis of 50 SNPs in CYP2D6, CYP2C19, CYP2C9, CYP3A4 and CYP1A2 by MALDI-TOF mass spectrometry in Chinese Han population.
21054464 2010 The effect of cytochrome P2C19 and interleukin-1 polymorphisms on H. pylori eradication rate of 1-week triple therapy with omeprazole or rabeprazole, amoxycillin and clarithromycin in Chinese people.
21054462 2010 Assessment of CYP2C19 genetic polymorphisms in a Korean population using a simultaneous multiplex pyrosequencing method to simultaneously detect the CYP2C19*2, CYP2C19*3, and CYP2C19*17 alleles.
21047200 2010 CYP2C19*2 polymorphism is associated with increased survival in breast cancer patients using tamoxifen.
21038076 2011 Effect of cytochrome P450 2C19 genotype on voriconazole exposure in cystic fibrosis lung transplant patients.
20979470 2010 Effects of CYP2C19 genotype on outcomes of clopidogrel treatment.
20978260 2010 Reduced-function CYP2C19 genotype and risk of adverse clinical outcomes among patients treated with clopidogrel predominantly for PCI: a meta-analysis.
20976881 2010 [Clinical implication of therapeutic drug monitoring on voriconazole from the aspect of the analysis for CYP2C19 gene].
20970553 2010 Toward personalized medicine in renal transplantation.
20965456 2010 Pilot study of the antiplatelet effect of increased clopidogrel maintenance dosing and its relationship to CYP2C19 genotype in patients with high on-treatment reactivity.
20941486 2011 NAT2, CYP2C9, CYP2C19, and CYP2E1 genetic polymorphisms in anti-TB drug-induced maculopapular eruption.
20926021 Relationship between the acid-inhibitory effects of two proton pump inhibitors and CYP2C19 genotype in Japanese subjects: a randomized two-way crossover study.
20924183 2010 Cytochrome P450 2C19 polymorphism, suboptimal reperfusion and all-cause mortality in patients with acute myocardial infarction.
20890775 2011 Linkage disequilibrium between the CYP2C19*17 and CYP2C8*2 alleles in populations of African descent.
20885015 Investigation of allele and genotype frequencies of CYP2C9, CYP2C19 and VKORC1 in Iran.
20863179 2010 Will a new genotyping test help the clinician predict response to antidepressant drugs?
20857895 2010 Prevalence of CYP450 gene variations in patients with type 2 diabetes.
20845310 2010 Genetic polymorphisms of cytochrome P450 enzymes 2C9 and 2C19 in a healthy Mongolian population in China.
20845077 2011 Cytochrome P450 2C19 polymorphism is associated with poor clinical outcomes in coronary artery disease patients treated with clopidogrel.
20838991 2010 Effect of CYP2C19 genotypes on the pharmacokinetic/pharmacodynamic relationship of rabeprazole after a single oral dose in healthy Chinese volunteers.
20833683 2010 CYP2C19*2 and CYP2C9*3 alleles are associated with stent thrombosis: a case-control study.
20831548 2010 Cytochrome P450 CYP2C19 genotypes in Nigerian sickle-cell disease patients and normal controls.
20831536 2010 Influence of CYP2C9 and CYP2C19 genetic polymorphisms on pharmacokinetics and pharmacodynamics of gliclazide in healthy Chinese Han volunteers.
20831535 2010 Pharmacogenetics of esomeprazole or rabeprazole-based triple therapy in Helicobacter pylori eradication in Hong Kong non-ulcer dyspepsia Chinese subjects.
20826260 2010 Protective effect of the CYP2C19 *17 polymorphism with increased activation of clopidogrel on cardiovascular events.
20823393 2010 Cytochrome 2C19 polymorphism and response to adjunctive cilostazol versus high maintenance-dose clopidogrel in patients undergoing percutaneous coronary intervention.
20804307 2010 Role of cytochrome P450 2C19 genetic polymorphisms in the therapeutic efficacy of omeprazole in Iranian patients with erosive reflux esophagitis.
20801498 2010 Effect of CYP2C19 and ABCB1 single nucleotide polymorphisms on outcomes of treatment with ticagrelor versus clopidogrel for acute coronary syndromes: a genetic substudy of the PLATO trial.
20801494 2010 Genetic variants in ABCB1 and CYP2C19 and cardiovascular outcomes after treatment with clopidogrel and prasugrel in the TRITON-TIMI 38 trial: a pharmacogenetic analysis.
20724801 2010 Pre-procedural platelet reactivity after clopidogrel loading in korean patients undergoing scheduled percutaneous coronary intervention.
20716514 2010 Time-saving multiplex detection of single nucleotide polymorphisms by ultrasensitive DNA microarray.
20716239 2010 Influences of different proton pump inhibitors on the anti-platelet function of clopidogrel in relation to CYP2C19 genotypes.
20708365 2010 Clopidogrel loading dose adjustment according to platelet reactivity monitoring in patients carrying the 2C19*2 loss of function polymorphism.
20684753 2010 No influence of the polymorphisms CYP2C19 and CYP2D6 on the efficacy of cyclophosphamide, thalidomide, and bortezomib in patients with Multiple Myeloma.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20673183 2010 The effect of CYP2C19 activity on pharmacokinetics of lansoprazole and its active metabolites in healthy subjects.
20669013 2010 Effects of erythromycin on voriconazole pharmacokinetics and association with CYP2C19 polymorphism.
20665013 2010 Linkage disequilibrium between the CYP2C19*17 allele and wildtype CYP2C8 and CYP2C9 alleles: identification of CYP2C haplotypes in healthy Nordic populations.
20650435 2010 Carriage of cytochrome 2C19 polymorphism is associated with risk of high post-treatment platelet reactivity on high maintenance-dose clopidogrel of 150 mg/day: results of the ACCEL-DOUBLE (Accelerated Platelet Inhibition by a Double Dose of Clopidogrel According to Gene Polymorphism) study.
20637959 2010 The impact of genetic polymorphisms and patient characteristics on warfarin dose requirements: a cross-sectional study in Iran.
20633187 2010 Rabeprazole can overcome the impact of CYP2C19 polymorphism on quadruple therapy.
20620727 2010 Cardiovascular risk in clopidogrel-treated patients according to cytochrome P450 2C19*2 loss-of-function allele or proton pump inhibitor coadministration: a systematic meta-analysis.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20602612 2010 Genetic profile of patients with epilepsy on first-line antiepileptic drugs and potential directions for personalized treatment.
20581929 2010 Is the prevalence of CYP2C19 genetic variants different in Pacific people than in New Zealand Europeans?
20573087 2010 Omeprazole-induced acute interstitial nephritis is not related to CYP2C19 genotype or CYP2C19 phenotype.
20565970 2010 Associations between tamoxifen, estrogens, and FSH serum levels during steady state tamoxifen treatment of postmenopausal women with breast cancer.
20559522 2010 The Influence of CYP2C19 Polymorphism on Eradication of Helicobacter pylori: A Prospective Randomized Study of Lansoprazole and Rabeprazole.
20549497 2010 Influence of CYP2C19 genotype on the pharmacokinetics of R483, a CYP2C19 substrate, in healthy subjects and type 2 diabetes patients.
20549256 2010 A genetic polymorphism of CYP2C19 is associated with susceptibility to biliary tract cancer.
20533108 2010 Influence of CYP2C19 functional polymorphism on Helicobacter pylori eradication.
20531370 2011 Association between CYP2C19*17 and metabolism of amitriptyline, citalopram and clomipramine in Dutch hospitalized patients.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20528170 2010 Influence of CYP2C19 and ABCB1 polymorphisms on plasma concentrations of lansoprazole enantiomers after enteral administration.
20510210 2010 Impact of cytochrome P450 2C19 loss-of-function polymorphism and of major demographic characteristics on residual platelet function after loading and maintenance treatment with clopidogrel in patients undergoing elective coronary stent placement.
20499227 2010 CYP2C19 activity comparison between Swedes and Koreans: effect of genotype, sex, oral contraceptive use, and smoking.
20492469 2010 Isolated and interactive impact of common CYP2C19 genetic variants on the antiplatelet effect of chronic clopidogrel therapy.
20492467 2010 Prasugrel vs. clopidogrel for cytochrome P450 2C19-genotyped subgroups: integration of the TRITON-TIMI 38 trial data.
20492431 2010 Can the genotype or phenotype of two polymorphic drug metabolising cytochrome P450-enzymes identify oral lichenoid drug eruptions?
20468063 2010 Association between CYP2C19 polymorphism and depressive symptoms.
20460345 2010 Association of interaction between smoking and CYP 2C19*3 polymorphism with coronary artery disease in a Uighur population.
20457439 2010 Correlation of CYP2C19 genetic polymorphisms with helicobacter pylori eradication in patients with cirrhosis and peptic ulcer.
20430047 2010 Biological definition of multiple chemical sensitivity from redox state and cytokine profiling and not from polymorphisms of xenobiotic-metabolizing enzymes.
20414645 2010 Influence of CYP2C19 on the relationship between pharmacokinetics and intragastric pH of omeprazole administered by successive intravenous infusions in Chinese healthy volunteers.
20390258 2010 Influence of CYP2C9 and CYP2C19 genetic polymorphisms on phenytoin-induced neurological toxicity in Indian epileptic patients.
20376628 2010 Effects of CYP2C19, MDR1, and interleukin 1-B gene variants on the eradication rate of Helicobacter pylori infection by triple therapy with pantoprazole, amoxicillin, and metronidazole.
20373852 2010 Microarray-based detection of CYP1A1, CYP2C9, CYP2C19, CYP2D6, GSTT1, GSTM1, MTHFR, MTRR, NQO1, NAT2, HLA-DQA1, and AB0 allele frequencies in native Russians.
20360782 2010 Prasugrel, M?ori, and personalised medicine in New Zealand.
20358205 2011 Pharmacogenetics of cyclophosphamide and CYP2C19 polymorphism in Thai systemic lupus erythematosus.
20356512 2010 [The polymorphism of cytochrome P(450) 2C19 gene in patients with invasive fungal infections.].
20351750 2011 Cytochrome P450 2C19*2 polymorphism and cardiovascular recurrences in patients taking clopidogrel: a meta-analysis.
20350136 2010 Genetic polymorphisms of cytochrome P450 enzymes influence metabolism of the antidepressant escitalopram and treatment response.
20350051 2010 Effect of glycyrrhizin on CYP2C19 and CYP3A4 activity in healthy volunteers with different CYP2C19 genotypes.
20349052 2010 [13C]pantoprazole breath test as a predictor of the anti-platelet function of clopidogrel.
20309015 2011 Efficacy of tamoxifen based on cytochrome P450 2D6, CYP2C19 and SULT1A1 genotype in the Italian Tamoxifen Prevention Trial.
20297661 2010 [Analysis of genetic predisposition to pulmonary tuberculosis in native Russians].
20236133 Donor graft does not affect the P450 2C19 genotype expressed in peripheral blood in recipients of living donor liver transplantation.
20235787 2010 Common sequence variants in pharmacodynamic and pharmacokinetic pathway-related genes conferring LDL cholesterol response to statins.
20223877 2010 Impact of the CYP2C19*17 allele on the pharmacokinetics of omeprazole and pantoprazole in children: evidence for a differential effect.
20207952 2010 Hepatic metabolism and transporter gene variants enhance response to rosuvastatin in patients with acute myocardial infarction: the GEOSTAT-1 Study.
20206639 2010 The transcription factor GATA-4 regulates cytochrome P4502C19 gene expression.
20179710 2010 Influence of pharmacogenetics on response and toxicity in breast cancer patients treated with doxorubicin and cyclophosphamide.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20163283 2010 Relation of CYP2C19 loss-of-function polymorphism to the occurrence of stent thrombosis.
20147896 2010 A phenotype-genotype approach to predicting CYP450 and P-glycoprotein drug interactions with the mixed inhibitor/inducer tipranavir/ritonavir.
20113968 2010 CYP17 and CYP2C19 gene polymorphisms in patients with endometriosis.
20088379 [Association of xenobiotic-metabolizing gene polymorphisms with childhood atopic diseases in Russian patients from the Republic of Bashkortostan].
20083681 2010 Cytochrome 2C19*17 allelic variant, platelet aggregation, bleeding events, and stent thrombosis in clopidogrel-treated patients with coronary stent placement.
20078610 2010 Population pharmacokinetic analysis of cilostazol in healthy subjects with genetic polymorphisms of CYP3A5, CYP2C19 and ABCB1.
20064729 2010 Genetic factors associated with drug-resistance of epilepsy: relevance of stratification by patient age and aetiology of epilepsy.
20040040 2010 Effect of an increased clopidogrel maintenance dose or lansoprazole co-administration on the antiplatelet response to clopidogrel in CYP2C19-genotyped healthy subjects.
20015960 2011 Traditional Medicine to Modern Pharmacogenomics: Ayurveda Prakriti Type and CYP2C19 Gene Polymorphism Associated with the Metabolic Variability.
20002085 2009 Pharmacokinetics, metabolism and bioavailability of the triazole antifungal agent voriconazole in relation to CYP2C19 genotype.
19968574 2010 CYP2C19 genotypes in the pharmacokinetics/pharmacodynamics of proton pump inhibitor-based therapy of Helicobacter pylori infection.
19961004 2009 [Effect of CYP2C19 gene polymorphism on eradication treatment efficacy of Helicobacter pylori infection].
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19954746 2010 Interaction of drug metabolizing cytochrome P450 2D6 poor metabolizers with cytochrome P450 2C9 and 2C19 genotypes modify the susceptibility to head and neck cancer and treatment response.
19954515 2009 Characterisation of CYP2C8, CYP2C9 and CYP2C19 polymorphisms in a Ghanaian population.
19942749 2009 Importance of CYP2C19 genetic polymorphism in the eradication of Helicobacter pylori in north Indians.
19940233 2010 Esophageal mucosal injury with low-dose aspirin and its prevention by rabeprazole.
19934793 2010 Besides CYP2C19*2, the variant allele CYP2C9*3 is associated with higher on-clopidogrel platelet reactivity in patients on dual antiplatelet therapy undergoing elective coronary stent implantation.
19933691 2010 Pharmacokinetics and safety of 14 days intravenous voriconazole in allogeneic haematopoietic stem cell transplant recipients.
19932784 2009 Relation of body mass index to high on-treatment platelet reactivity and of failed clopidogrel dose adjustment according to platelet reactivity monitoring in patients undergoing percutaneous coronary intervention.
19928008 2009 [Study of gene polymorphism responsible for metabolism of proton pump inhibitors in children with H. pylori infection: is there a correlation with efficacy of eradication treatment?].
19926050 2009 Pharmacogenetic testing for clopidogrel using the rapid INFINITI analyzer: a dose-escalation study.
19907421 2010 High frequency of occurrence of CYP2D6 gene duplication/multiduplication indicating ultrarapid metabolism among suicide cases.
19904250 2010 Double-dosed pantoprazole accelerates the sustained symptomatic response in overweight and obese patients with reflux esophagitis in Los Angeles grades A and B.
19891553 2009 Genetic polymorphisms of drug-metabolizing enzymes and anti-TB drug-induced hepatitis.
19890215 2010 CYP2C19 genetic variants affect nelfinavir pharmacokinetics and virologic response in HIV-1-infected children receiving highly active antiretroviral therapy.
19884907 2010 The CYP2C19*17 genotype is associated with lower imipramine plasma concentrations in a large group of depressed patients.
19881258 2009 Absence of influence of concomitant administration of rabeprazole on the pharmacokinetics of tacrolimus in adult living-donor liver transplant patients: a case-control study.
19847408 2010 The effects of CYP2C9 and CYP2C19 genetic polymorphisms on the pharmacokinetics and pharmacodynamics of glipizide in Chinese subjects.
19841156 2010 Effect of age, weight, and CYP2C19 genotype on escitalopram exposure.
19840783 2010 Evaluation of the influence of sex and CYP2C19 and CYP2D6 polymorphisms in the disposition of citalopram.
19823875 2010 Molecular genetics and epigenetics of the cytochrome P450 gene family and its relevance for cancer risk and treatment.
19821196 2009 The prevalence of CYP2C19 mutations in Turkish patients with dyspepsia.
19817997 2010 The effect of elinogrel on high platelet reactivity during dual antiplatelet therapy and the relation to CYP2C19*2 genotype: first experience in patients.
19773541 2009 Identification of a novel CYP2C19-mediated metabolic pathway of S-citalopram in vitro.
19761366 2009 Effects of genetic variation at the CYP2C19/CYP2C9 locus on pharmacokinetics of chlorcycloguanil in adult Gambians.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19745563 2009 VKORC1 diplotype-derived dosing model to explain variability in warfarin dose requirements in Asian patients.
19712984 2010 Impact of loading dose adjustment on platelet reactivity in homozygotes of the 2C19 2* loss of function polymorphism.
19706858 2009 Association of cytochrome P450 2C19 genotype with the antiplatelet effect and clinical efficacy of clopidogrel therapy.
19702490 2009 Drug-metabolizing enzyme genotypes and aggressive behavior treatment response in hospitalized pediatric psychiatric patients.
19696793 2009 Association study of genetic polymorphism in ABCC4 with cyclophosphamide-induced adverse drug reactions in breast cancer patients.
19693007 2009 Association of CYP2B6, CYP3A5, and CYP2C19 genetic polymorphisms with sibutramine pharmacokinetics in healthy Korean subjects.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19661214 2009 Identification of new CYP2C19 variants exhibiting decreased enzyme activity in the metabolism of S-mephenytoin and omeprazole.
19651758 2009 Hepatic cytochrome P450 enzyme alterations in humans with progressive stages of nonalcoholic fatty liver disease.
19638460 2009 Valproic acid at therapeutic plasma levels may increase 5-azacytidine efficacy in higher risk myelodysplastic syndromes.
19636337 2009 Genetic polymorphism, linkage disequilibrium, haplotype structure and novel allele analysis of CYP2C19 and CYP2D6 in Han Chinese.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19624462 2009 CYP2C19*2 polymorphism is not the sole determinant of the response to clopidogrel: implications for its monitoring.
19621685 Influences of CYP2C19 polymorphism on recurrence of reflux esophagitis during proton pump inhibitor maintenance therapy.
19617466 2009 CYP2C9, CYP2C19, and ABCB1 genotype and hospitalization for phenytoin toxicity.
19593168 2009 ABCB1 and cytochrome P450 polymorphisms: clinical pharmacogenetics of clozapine.
19593158 2009 Cytochrome P450 CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes are not associated with response and remission in a sample of depressive patients.
19583677 2009 CYP2C19 haplotypes in Koreans as a marker of enzyme activity evaluated with omeprazole.
19578179 2009 A genome-wide association study of acenocoumarol maintenance dosage.
19576320 2009 Relation of genetic polymorphisms in the cytochrome P450 gene with clopidogrel resistance after drug-eluting stent implantation in Koreans.
19552744 2009 Pharmacokinetic- pharmacodynamic analysis of the role of CYP2C19 genotypes in short-term rabeprazole-based triple therapy against Helicobacter pylori.
19546880 2009 Influence of ethnicity on pharmacogenetic variation in the Ghanaian population.
19534586 2009 Membrane integration of recombinant human P450 forms.
19531897 2009 Impact of CYP2C19 polymorphisms on the antiplatelet effect of clopidogrel in an actual clinical setting in Japan.
19516253 2009 Influence of CYP3A and CYP2C19 genetic polymorphisms on the pharmacokinetics of cilostazol in healthy subjects.
19499406 2009 Role of CYP2C19 polymorphisms in patients with endometriosis.
19496924 2009 The CYP2C19*17 allele is associated with better platelet response to clopidogrel in patients admitted for non-ST acute coronary syndrome.
19474452 2009 Perioperative genomic profiles using structure-specific oligonucleotide probes.
19430176 2009 Genetic variations and haplotypes of the 5' regulatory region of CYP2C19 in South Indian population.
19429918 2009 Genetic variation of CYP2C19 affects both pharmacokinetic and pharmacodynamic responses to clopidogrel but not prasugrel in aspirin-treated patients with coronary artery disease.
19424794 2010 Genetic polymorphisms in phase I and phase II enzymes and breast cancer risk associated with menopausal hormone therapy in postmenopausal women.
19415824 2009 Non-response to antiepileptic pharmacotherapy is associated with the ABCC2 -24C>T polymorphism in young and adult patients with epilepsy.
19415745 2009 Genetic polymorphisms of estrogen metabolizing enzyme and breast cancer risk in Thai women.
19414633 2009 Cytochrome P450 genetic polymorphisms and the response to prasugrel: relationship to pharmacokinetic, pharmacodynamic, and clinical outcomes.
19407662 A comparative study of proton-pump inhibitor tests for Chinese reflux patients in relation to the CYP2C19 genotypes.
19404631 2009 Impact of CYP2C19 phenotypes on escitalopram metabolism and an evaluation of pupillometry as a serotonergic biomarker.
19398604 2009 Clopidogrel inhibits CYP2C19-dependent hydroxylation of omeprazole related to CYP2C19 genetic polymorphisms.
19350405 2009 Population study of genetic polymorphisms and superficial bladder cancer risk in Han-Chinese smokers in Shanghai.
19348299 2009 [Polymorphism of cytochrome P-450 gene in the light of Helicobacter pylori eradication efficiency].
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19337788 2009 Frequency of CYP3A4, CYP3A5, CYP2C9, and CYP2C19 variant alleles in patients receiving clopidogrel that experience repeat acute coronary syndrome.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19299322 2009 Lack of effect of Ginkgo biloba on voriconazole pharmacokinetics in Chinese volunteers identified as CYP2C19 poor and extensive metabolizers.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
19268736 2009 Relation of cytochrome P450 2C19 loss-of-function polymorphism to occurrence of drug-eluting coronary stent thrombosis.
19261446 2009 Correlation between voriconazole trough plasma concentration and hepatotoxicity in patients with different CYP2C19 genotypes.
19259653 2009 CYP2C19 genotype is associated with symptomatic recurrence of GERD during maintenance therapy with low-dose lansoprazole.
19246508 2009 Efficacy of levofloxacin-based rescue therapy for Helicobacter pylori infection after standard triple therapy: a randomized controlled trial.
19238367 2009 Effect of MDR1 C3435T polymorphism on lansoprazole in healthy Japanese subjects.
19236548 2009 Blood concentration of pantoprazole sodium is significantly high in hepatogenic peptic ulcer patients, especially those with a poor CYP2C19 metabolism.
19220726 2009 The CYP2C19*2 and CYP2C19*3 polymorphisms are associated with high post-treatment platelet reactivity in Asian patients with acute coronary syndrome.
19219744 2009 Acetaminophen bioactivation by human cytochrome P450 enzymes and animal microsomes.
19199010 2009 Covariate-based dose individualization of the cytotoxic drug indisulam to reduce the risk of severe myelosuppression.
19193970 2009 CYP2C19 genotypes in a population of healthy volunteers and in children with hematological malignancies in Gaza Strip.
19193675 2009 Cytochrome P450 2C19 loss-of-function polymorphism and stent thrombosis following percutaneous coronary intervention.
19192051 2009 Polymorphic drug metabolizing CYP-enzymes--a pathogenic factor in oral lichen planus?
19176055 2008 [Effect of cytochrome CYP2C19 on the anti-myeloma activity of thalidomide in vitro].
19172254 2009 Effects of allicin on CYP2C19 and CYP3A4 activity in healthy volunteers with different CYP2C19 genotypes.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19169185 2009 DNA microarray technology in the clinical environment: the AmpliChip CYP450 test for CYP2D6 and CYP2C19 genotyping.
19166419 2008 Effect of CYP2C19 genetic polymorphisms on the efficacy of proton pump inhibitor-based triple therapy for Helicobacter pylori eradication: a meta-analysis.
19164093 2009 Novel variants of major drug-metabolising enzyme genes in diverse African populations and their predicted functional effects.
19156902 2009 Genetic polymorphisms of CYP2D6 10 and CYP2C19 2, 3 are not associated with prognosis, endometrial thickness, or bone mineral density in Japanese breast cancer patients treated with adjuvant tamoxifen.
19151603 2009 Pharmacogenetic variation at CYP2C9, CYP2C19, and CYP2D6 at global and microgeographic scales.
19139162 2009 Impact of intestinal CYP2C19 genotypes on the interaction between tacrolimus and omeprazole, but not lansoprazole, in adult living-donor liver transplant patients.
19136640 2009 Rapid identification of the hepatic cytochrome P450 2C19 activity using a novel and noninvasive [13C]pantoprazole breath test.
19129087 2008 A high incidence of polymorphic CYP2C19 variants in archival blood samples from Papua New Guinea.
19108880 2009 Cytochrome P450 2C19 polymorphism in young patients treated with clopidogrel after myocardial infarction: a cohort study.
19106084 2009 Cytochrome p-450 polymorphisms and response to clopidogrel.
19106083 2009 Genetic determinants of response to clopidogrel and cardiovascular events.
19102714 2009 Need for reassessment of reported CYP2C19 allele frequencies in various populations in view of CYP2C19*17 discovery: the case of Greece.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19069365 2008 Prevalence of CYP2C19 gene polymorphisms in the Puerto Rican population: a preliminary report.
19038035 2008 Few alterations in clinical pathology and histopathology observed in a CYP2C18&19 humanized mice model.
19033450 2009 CYP2C19 genotype is a major factor contributing to the highly variable pharmacokinetics of voriconazole.
19029318 2009 Comprehensive in vitro analysis of voriconazole inhibition of eight cytochrome P450 (CYP) enzymes: major effect on CYPs 2B6, 2C9, 2C19, and 3A.
19025845 2000 Drug metabolism genotypes and their association with adverse drug reactions in selected populations: a pilot study of methodology.
19002442 2009 Cytochrome P450 2C19 genetic polymorphisms in Ugandans.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18982321 2009 The CYP2C19 ultra-rapid metabolizer genotype influences the pharmacokinetics of voriconazole in healthy male volunteers.
18979093 2009 Pharmacogenomics of CYP2A6, CYP2B6, CYP2C19, CYP2D6, CYP3A4, CYP3A5 and MDR1 in Vietnam.
18957504 2009 Extraadrenal 21-hydroxylation by CYP2C19 and CYP3A4: effect on 21-hydroxylase deficiency.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18854824 2008 CYP2C19 pharmacogenetics in advanced cancer: compromised function independent of genotype.
18854779 2008 Relations between polymorphisms in drug-metabolising enzymes and toxicity of chemotherapy with cyclophosphamide, thiotepa and carboplatin.
18823430 2009 Effects of CYP2C19 and MDR1 genotype on the eradication rate of Helicobacter pylori infection by triple therapy with pantoprazole, amoxycillin and clarithromycin.
18781853 2008 CYP2C19 and nongenetic factors predict poor responsiveness to clopidogrel loading dose after coronary stent implantation.
18765869 2008 Genetic polymorphism of CYP2C19 & therapeutic response to proton pump inhibitors.
18751689 2009 Optimal dose regimens of esomeprazole for gastric acid suppression with minimal influence of the CYP2C19 polymorphism.
18702650 2008 Body mass index can determine the healing of reflux esophagitis with Los Angeles Grades C and D by esomeprazole.
18677622 2008 Serum concentrations of sertraline and N-desmethyl sertraline in relation to CYP2C19 genotype in psychiatric patients.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18654768 2008 Kinetics of omeprazole and escitalopram in relation to the CYP2C19*17 allele in healthy subjects.
18644391 2008 Association of poor metabolizers of cytochrome P450 2C19 with head and neck cancer and poor treatment response.
18641551 2008 Population estimation regarding the effects of cytochrome P450 2C19 and 3A5 polymorphisms on zonisamide clearance.
18637061 2008 Effect of the CYP2C19 polymorphism on the eradication rate of Helicobacter pylori infection by 7-day triple therapy with regular proton pump inhibitor dosage.
18581106 2008 Investigation of the in vivo activity of CYP3A in Brazilian volunteers: comparison of midazolam and omeprazole as drug markers.
18577829 2008 Coexisting polymorphisms of P2Y12 and CYP2C19 genes as a risk factor for persistent platelet activation with clopidogrel.
18551037 2008 Pharmacogenetics of P450 oxidoreductase: effect of sequence variants on activities of CYP1A2 and CYP2C19.
18532997 2008 The common gene variants of CYP2C19 affect pharmacokinetics and pharmacodynamics in an active metabolite of clopidogrel in healthy subjects.
18521743 2009 CYP2C19*17 is associated with decreased breast cancer risk.
18520598 2008 The role of cytochrome P2C19 in R-warfarin pharmacokinetics and its interaction with omeprazole.
18520596 2008 The impact of CYP2D6 and CYP2C19 polymorphisms on suicidal behavior and substance abuse disorder among patients with schizophrenia: a retrospective study.
18518848 2008 Genetic polymorphism analysis of CYP2C19 in Chinese Han populations from different geographic areas of mainland China.
18511451 2008 Important amino acid residues that confer CYP2C19 selective activity to CYP2C9.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18496682 2008 Genetic polymorphism of CYP1A2 and the toxicity of leflunomide treatment in rheumatoid arthritis patients.
18496131 2008 Influence of polymorphisms of drug metabolizing enzymes (CYP2B6, CYP2C9, CYP2C19, CYP3A4, CYP3A5, GSTA1, GSTP1, ALDH1A1 and ALDH3A1) on the pharmacokinetics of cyclophosphamide and 4-hydroxycyclophosphamide.
18482659 2008 Cytochrome P450 2C19 681G>A polymorphism and high on-clopidogrel platelet reactivity associated with adverse 1-year clinical outcome of elective percutaneous coronary intervention with drug-eluting or bare-metal stents.
18466100 2008 Impact of CYP2C19 polymorphisms on the efficacy of clobazam therapy.
18425152 2008 Allele frequency differences of cytochrome P450 polymorphisms in a sample of New Zealand M?ori.
18423013 2008 Implication of Xenobiotic Metabolizing Enzyme gene (CYP2E1, CYP2C19, CYP2D6, mEH and NAT2) polymorphisms in breast carcinoma.
18399167 2007 [Effect of CYP2C19 gene polymorphism on efficacy of thalidomide-based regimens for the treatment of multiple myeloma].
18394438 2008 Effect of cytochrome p450 polymorphisms on platelet reactivity after treatment with clopidogrel in acute coronary syndrome.
18382661 2008 Pharmacokinetic genes do not influence response or tolerance to citalopram in the STAR*D sample.
18356043 2008 Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone.
18346178 2008 Inhibition of ADP-induced platelet aggregation by clopidogrel is related to CYP2C19 genetic polymorphisms.
18323861 2008 The effect of CYP2C19 polymorphism on the pharmacokinetics and pharmacodynamics of clopidogrel: a possible mechanism for clopidogrel resistance.
18319058 2008 Pharmacokinetics of the new proton pump inhibitor ilaprazole in Chinese healthy subjects in relation to CYP3A5 and CYP2C19 genotypes.
18312490 2008 Influence of CYP2C19*18 and CYP2C19*19 alleles on omeprazole 5-hydroxylation: in vitro functional analysis of recombinant enzymes expressed in Saccharomyces cerevisiae.
18294333 2008 Increased omeprazole metabolism in carriers of the CYP2C19*17 allele; a pharmacokinetic study in healthy volunteers.
18241287 2008 Limited frequency of the CYP2C19*17 allele and its minor role in a Japanese population.
18241283 2008 Effect of CYP2C19*2 and *17 mutations on pharmacodynamics and kinetics of proton pump inhibitors in Caucasians.
18240905 2007 CYP2C9, CYP2C19 and CYP2D6 allele frequencies in the Ashkenazi Jewish population.
18240903 2007 Pharmacogenetically relevant polymorphisms in Portugal.
18231117 2008 Pharmacokinetics/genotype associations for major cytochrome P450 enzymes in native and first- and third-generation Japanese populations: comparison with Korean, Chinese, and Caucasian populations.
18224311 2008 Estimation of the area under the concentration-time curve of racemic lansoprazole by using limited plasma concentration of lansoprazole enantiomers.
18223462 2008 Influence of lansoprazole and rabeprazole on mycophenolic acid pharmacokinetics one year after renal transplantation.
18214455 2008 Effects of the CYP3A5 genotype on omeprazole sulfoxidation in CYP2C19 PMs.
18211619 2008 The effect of CYP2C19 genotypes on the pharmacokinetics of warfarin enantiomers.
18205890 2008 Genetic Polymorphism of CYP2C19 gene in the Stanislas cohort. A link with inflammation.
18154472 2008 Association of galactose single-point test levels and phenytoin metabolic polymorphisms with gingival hyperplasia in patients receiving long-term phenytoin therapy.
18061941 2008 Polymorphisms in xenobiotic-metabolizing genes and the risk of chronic lymphocytic leukemia and non-Hodgkin's lymphoma in adult Russian patients.
18057705 2007 Population pharmacokinetics and proton pump inhibitory effects of intravenous lansoprazole in healthy Japanese males.
18024866 2007 Breast cancer treatment outcome with adjuvant tamoxifen relative to patient CYP2D6 and CYP2C19 genotypes.
18021343 2007 Pharmacogenetics of acenocoumarol: CYP2C9, CYP2C19, CYP1A2, CYP3A4, CYP3A5 and ABCB1 gene polymorphisms and dose requirements.
18004210 2007 Cytochrome P450 2C19 loss-of-function polymorphism, but not CYP3A4 IVS10 + 12G/A and P2Y12 T744C polymorphisms, is associated with response variability to dual antiplatelet treatment in high-risk vascular patients.
17992535 2008 Correlation of inter-individual variations of amitriptyline metabolism examined in hairs with CYP2C19 and CYP2D6 polymorphisms.
17978853 2007 Genetic polymorphism of CYP2C19 in Maharashtrian population.
17966194 2007 [Genotyping of CYP2D6 and CYP2C19].
17934830 2008 Endoscopic analysis of gastric ulcer after one week's treatment with omeprazole and rabeprazole in relation to CYP2C19 genotype.
17924835 2007 CYP2C19 pharmacogenomics associated with therapy of Helicobacter pylori infection and gastro-esophageal reflux diseases with a proton pump inhibitor.
17922881 2008 Effect of CYP2C19 polymorphism on nelfinavir to M8 biotransformation in HIV patients.
17909762 2007 Rapid genotyping of CYP2D6, CYP2C19 and TPMT polymorphisms by primer extension reaction in a dipstick format.
17900275 2007 Common polymorphisms of CYP2C19 and CYP2C9 affect the pharmacokinetic and pharmacodynamic response to clopidogrel but not prasugrel.
17875119 2007 Effects of CYP2C19 genetic polymorphism on the pharmacokinetics and pharmacodynamics of omeprazole in Chinese people.
17868191 2008 Role of CYP2C9 and CYP2C19 polymorphisms in patients with atherosclerosis.
17827141 2007 Hepatotoxicity of oral and intravenous voriconazole in relation to cytochrome P450 polymorphisms.
17697203 2007 Effect of MDR1 C3435T polymorphism on cure rates of Helicobacter pylori infection by triple therapy with lansoprazole, amoxicillin and clarithromycin in relation to CYP 2C19 genotypes and 23S rRNA genotypes of H. pylori.
17697139 2007 Influence of CYP2C19 and CYP3A4 gene polymorphisms on clopidogrel responsiveness in healthy subjects.
17681590 2008 Biological effect of increased maintenance dose of clopidogrel in cardiovascular outpatients and influence of the cytochrome P450 2C19*2 allele on clopidogrel responsiveness.
17680025 2007 Cytochrome P450 2C19 loss-of-function polymorphism is associated with an increased treatment-related mortality in patients undergoing allogeneic transplantation.
17667959 2008 Association of graded allele-specific changes in CYP2D6 function with imipramine dose requirement in a large group of depressed patients.
17667801 2007 Comparisons of CYP2C19 genetic polymorphisms between Korean and Vietnamese populations.
17666363 2007 Polymorphisms of CYP2C19 gene are associated with the efficacy of thalidomide based regimens in multiple myeloma.
17635181 2007 Genetic polymorphisms of drug-metabolizing enzymes CYP2D6, CYP2C9, CYP2C19 and CYP3A5 in the Greek population.
17635176 2007 Genetic polymorphism of cytochrome P450s and P-glycoprotein in the Finnish population.
17625515 2008 Impact of the ultrarapid CYP2C19*17 allele on serum concentration of escitalopram in psychiatric patients.
17623107 2007 Phenotype-genotype analysis of CYP2C19 in Colombian mestizo individuals.
17562299 2007 Contributions of CYP2C9/CYP2C19 genotypes and drug interaction to the phenytoin treatment in the Korean epileptic patients in the clinical setting.
17559380 2007 Influence of cytochrome P450 2C19 genetic polymorphism and dosage of rabeprazole on accuracy of proton-pump inhibitor testing in Chinese patients with gastroesophageal reflux disease.
17504998 2007 CYP2C9 and CYP2C19 polymorphic forms are related to increased indisulam exposure and higher risk of severe hematologic toxicity.
17502835 2007 Genetic polymorphisms of CYP2B6 affect the pharmacokinetics/pharmacodynamics of cyclophosphamide in Japanese cancer patients.
17487889 2007 Stereoselective hexobarbital 3'-hydroxylation by CYP2C19 expressed in yeast cells and the roles of amino acid residues at positions 300 and 476.
17455109 2007 Functional characterization of two novel CYP2C19 variants (CYP2C19*18 and CYP2C19*19) found in a Japanese population.
17450472 2007 CYP450 polymorphisms predict clinic outcomes to vinorelbine-based chemotherapy in patients with non-small-cell lung cancer.
17439410 Cyp2c19 genotype and omeprazole hydroxylation phenotype in Chinese Li population.
17433262 2007 Roles of CYP3A4 and CYP2C19 in methyl hydroxylated and N-oxidized metabolite formation from voriconazole, a new anti-fungal agent, in human liver microsomes.
17424941 2007 CYP2C19 polymorphism in Korean patients on warfarin therapy.
17418993 2007 Development and full validation of six inhibition assays for five major cytochrome P450 enzymes in human liver microsomes using an automated 96-well microplate incubation format and LC-MS/MS analysis.
17417917 2007 [Helicobacter pylori erradication and its relation to antibiotic resistance and CYP2C19 status].
17410461 2007 Acid-suppressive effects of various regimens of omeprazole in Helicobacter pylori-negative CYP2C19 homozygous extensive metabolizers: which regimen has the strongest effect?
17407229 2007 Cytochrome P450 polymorphism as a predictor of ovarian toxicity to pulse cyclophosphamide in systemic lupus erythematosus.
17377957 2007 Influence of rabeprazole and lansoprazole on the pharmacokinetics of tacrolimus in relation to CYP2C19, CYP3A5 and MDR1 polymorphisms in renal transplant recipients.
17358097 2007 Influence of cytochrome P450 (CYP) 3A5 polymorphisms on the pharmacokinetics of lansoprazole enantiomers in CYP2C19 extensive metaboliser renal transplant recipients.
17357148 2007 Association between cytochrome P450 (CYP) 2C19 polymorphisms and harm avoidance in Japanese.
17304159 2007 Population estimation of the effects of cytochrome P450 2C9 and 2C19 polymorphisms on phenobarbital clearance in Japanese.
17298483 2007 Influence of CYP2C9 and CYP2C19 genetic polymorphisms on pharmacokinetics of gliclazide MR in Chinese subjects.
17295875 2007 Cytochrome P450 2C19 polymorphism influences the preventive effect of lansoprazole on the recurrence of erosive reflux esophagitis.
17290075 2006 CYP2C19 polymorphisms in patients with gastric and colorectal carcinoma.
17279092 2007 Genetic polymorphisms of CYP2C9 and CYP2C19 are not related to drug-induced idiosyncratic liver injury (DILI).
17269966 2007 Cytochrome P450 polymorphisms in patients with Behcet's disease.
17215846 2007 Pharmacogenomics-based tailored versus standard therapeutic regimen for eradication of H. pylori.
17203292 2007 Absolute bioavailability and metabolism of omeprazole in relation to CYP2C19 genotypes following single intravenous and oral administrations.
17201743 Genetic polymorphisms of cytochrome P450 enzymes 2C9 and 2C19 in a healthy Iranian population.
17178267 2006 ABCB1 and cytochrome P450 genotypes and phenotypes: influence on methadone plasma levels and response to treatment.
17112810 2006 Initial 48-hour acid inhibition by intravenous infusion of omeprazole, famotidine, or both in relation to cytochrome P450 2C19 genotype status.
17052843 2007 CYP2C19 polymorphism affects personality traits of Japanese females.
17048007 2007 Association of warfarin dose with genes involved in its action and metabolism.
17047492 2006 Multilocus genetic interactions and response to efavirenz-containing regimens: an adult AIDS clinical trials group study.
17047431 2006 [Influence of CYP2C19 polymorphism and Helicobacter pylori status on the antisecretory effect of omeprazole in gastroesophageal reflux disease].
17003844 2006 Eradication rate of Helicobacter pylori according to genotypes of CYP2C19, IL-1B, and TNF-A.
16960452 2006 CYP2C19 polymorphism and risk for essential tremor.
16946555 2006 CYP2C19 genetic polymorphism in Thai, Burmese and Karen populations.
16937451 2006 Pharmacodynamic and kinetic effect of rabeprazole on serum gastrin level in relation to CYP2C19 polymorphism in Chinese Hans.
16924387 2006 The high prevalence of the poor and ultrarapid metabolite alleles of CYP2D6, CYP2C9, CYP2C19, CYP3A4, and CYP3A5 in Taiwanese population.
16912869 2006 Effect of CYP2C19*17 gene variant on Helicobacter pylori eradication in peptic ulcer patients.
16911688 2006 Therapeutic effects of 10 mg/day rabeprazole administration on reflux esophagitis was not influenced by the CYP2C19 polymorphism.
16908943 2006 Late-onset life threatening hemorrhage of omeprazole-resistant duodenal ulcer managed by interventional radiology: report of a case.
16890578 2006 VKORC1 gene variations are the major contributors of variation in warfarin dose in Japanese patients.
16890574 2006 Potent cytochrome P450 2C19 genotype-related interaction between voriconazole and the cytochrome P450 3A4 inhibitor ritonavir.
16873909 2006 Influence of the CYP2C9 AND CYP2C19 polymorphisms on phenytoin hydroxylation in healthy individuals from south India.
16863547 2006 The effect of CYP2C19 polymorphisms on H. pylori eradication rate in dual and triple first-line PPI therapies: a meta-analysis.
16862439 2006 Engineering human cytochrome P450 enzymes into catalytically self-sufficient chimeras using molecular Lego.
16855453 2006 Phenotype-genotype relationship and clinical effects of citalopram in Chinese patients.
16815316 2006 Influences of proinflammatory and anti-inflammatory cytokine polymorphisms on eradication rates of clarithromycin-sensitive strains of Helicobacter pylori by triple therapy.
16815315 2006 Genetic polymorphism of cytochrome P450 2C19 in Mexican Americans: a cross-ethnic comparative study.
16812949 2006 Cytochrome P-450 2D6 and 2C19 polymorphisms and length of hospitalization in psychiatry.
16789993 2006 Effect of CYP2C19 genetic polymorphism on pharmacokinetics of phenytoin and phenobarbital in Japanese epileptic patients using Non-linear Mixed Effects Model approach.
16783561 2006 Effects of clarithromycin and verapamil on rabeprazole pharmacokinetics between CYP2C19 genotypes.
16772608 2006 Cytochrome P450 2C19 loss-of-function polymorphism is a major determinant of clopidogrel responsiveness in healthy subjects.
16771603 2006 Pharmacogenetic screening for polymorphisms in drug-metabolizing enzymes and drug transporters in a Dutch population.
16740190 2007 Influence of smoking and CYP2C19 genotypes on H. pylori eradication success.
16641871 2006 Differences in cytochrome P450 2C19 (CYP2C19) expression in adjacent normal and tumor tissues in Chinese cancer patients.
16638864 2006 Association of DNA repair and steroid metabolism gene polymorphisms with clinical late toxicity in patients treated with conformal radiotherapy for prostate cancer.
16595916 2006 Multiple regression analysis of pharmacogenetic variability of carvedilol disposition in 54 healthy Japanese volunteers.
16487225 2006 Enantioselective disposition of rabeprazole in relation to CYP2C19 genotypes.
16487224 2006 Different effects of fluvoxamine on rabeprazole pharmacokinetics in relation to CYP2C19 genotype status.
16413245 2006 A common novel CYP2C19 gene variant causes ultrarapid drug metabolism relevant for the drug response to proton pump inhibitors and antidepressants.
16401082 2006 Radical intermediates in the catalytic oxidation of hydrocarbons by bacterial and human cytochrome P450 enzymes.
16338280 2005 CYP2C19 genotype affects diazepam pharmacokinetics and emergence from general anesthesia.
16338278 2005 Esomeprazole-induced healing of gastroesophageal reflux disease is unrelated to the genotype of CYP2C19: evidence from clinical and pharmacokinetic data.
16338275 2005 Methadone enantiomer plasma levels, CYP2B6, CYP2C19, and CYP2C9 genotypes, and response to treatment.
16307177 2006 Novel mutations in the cytochrome P450 2C19 gene: a pitfall of the PCR-RFLP method for identifying a common mutation.
16268979 2005 Poor metabolizer genotype status of CYP2C19 is a risk factor for developing gastric cancer in Japanese patients with Helicobacter pylori infection.
16267764 2005 Pharmacogenetics of long-term responses to antiretroviral regimens containing Efavirenz and/or Nelfinavir: an Adult Aids Clinical Trials Group Study.
16261363 2005 Pharmacokinetics and pharmacodynamics of etizolam are influenced by polymorphic CYP2C19 activity.
16239354 2005 In vivo metabolic activity of CYP2C19 and CYP3A in relation to CYP2C19 genetic polymorphism in chronic liver disease.
16236141 2005 Influence of CYP2C9, 2C19 and 2D6 genetic polymorphisms on the steady-state plasma concentrations of the enantiomers of fluoxetine and norfluoxetine.
16232205 2005 Phase I pharmacokinetic and pharmacogenomic study of E7070 administered once every 21 days.
16231968 2005 The effect of aging on the relationship between the cytochrome P450 2C19 genotype and omeprazole pharmacokinetics.
16220110 2005 CYP2C9, CYP2C19, ABCB1 (MDR1) genetic polymorphisms and phenytoin metabolism in a Black Beninese population.
16198656 2005 CYP2C9, but not CYP2C19, polymorphisms affect the pharmacokinetics and pharmacodynamics of glyburide in Chinese subjects.
16183265 2006 Pharmacogenetics of cyclophosphamide in patients with hematological malignancies.
16141610 2005 Genetic variations and haplotypes of CYP2C19 in a Japanese population.
16133961 2005 A comparative study on endoscopic ulcer healing of omeprazole versus rabeprazole with respect to CYP2C19 genotypic differences.
16116487 2005 Association of cyclophosphamide pharmacokinetics to polymorphic cytochrome P450 2C19.
16048566 2005 Genetic polymorphisms of cytochrome P450 in patients with hepatitis C virus-associated hepatocellular carcinoma.
16025294 2005 Polymorphism of CYP2D6, CYP2C19, CYP2C9 and CYP2C8 in the Faroese population.
16024198 2006 CYP2D6 and CYP2C19 genotypes and amitriptyline metabolite ratios in a series of medicolegal autopsies.
16021435 2005 The CYP2C19 genotype and the use of oral contraceptives influence the pharmacokinetics of carisoprodol in healthy human subjects.
16012079 2005 Comparison of enantioselective disposition of rabeprazole versus lansoprazole in renal-transplant recipients who are CYP2C19 extensive metabolizers.
16006997 2005 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of colorectal cancer.
15976989 2005 Effect of CYP2C19 and MDR1 polymorphisms on cure rate in patients with acid-related disorders with Helicobacter pylori infection.
15963095 2005 Enantioselective disposition of lansoprazole in relation to CYP2C19 genotypes in the presence of fluvoxamine.
15963082 2005 Effect of concomitant dosing of famotidine with lansoprazole on gastric acid secretion in relation to CYP2C19 genotype status.
15952098 2005 Influence of CYP2C19 polymorphism and Helicobacter pylori genotype determined from gastric tissue samples on response to triple therapy for H pylori infection.
15932363 2005 Effect of CYP2C19 polymorphism on the safety and efficacy of omeprazole in Japanese patients with recurrent reflux oesophagitis.
15903128 2005 Comparison of an increased dosage regimen of rabeprazole versus a concomitant dosage regimen of famotidine with rabeprazole for nocturnal gastric acid inhibition in relation to cytochrome P450 2C19 genotypes.
15856433 2005 Effect of clarithromycin on the enantioselective disposition of lansoprazole in relation to CYP2C19 genotypes.
15855721 2005 Evaluation of phenytoin dosage regimens based on genotyping of CYP2C subfamily in routinely treated Japanese patients.
15842554 2005 Chlorpropamide 2-hydroxylation is catalysed by CYP2C9 and CYP2C19 in vitro: chlorpropamide disposition is influenced by CYP2C9, but not by CYP2C19 genetic polymorphism.
15813658 2005 Cytochrome p450 polymorphisms in geriatric patients: impact on adverse drug reactions--a pilot study.
15776277 2005 Genetic polymorphism of CYP2C9 and CYP2C19 in a Bolivian population: an investigative and comparative study.
15752376 2005 Effects of clarithromycin on lansoprazole pharmacokinetics between CYP2C19 genotypes.
15715938 2005 Pharmacodynamic effects and kinetic disposition of rabeprazole in relation to CYP2C19 genotype in healthy Chinese subjects.
15691505 2005 High-throughput detection of multiple genetic polymorphisms influencing drug metabolism with mismatch primers in allele-specific polymerase chain reaction.
15691303 2005 Esomeprazole 40 mg twice daily in triple therapy and the efficacy of Helicobacter pylori eradication related to CYP2C19 metabolism.
15680923 2005 Interactions of mammalian cytochrome P450, NADPH-cytochrome P450 reductase, and cytochrome b(5) enzymes.
15662508 2005 The effect of the CYP2C19 genotype on the hydroxylation index of omeprazole in South Indians.
15660966 2005 CYP2C9 and CYP2C19 genetic polymorphisms: frequencies in the south Indian population.
15651900 2004 Polymorphisms of CYP2C19 and CYP2D6 in Israeli ethnic groups.
15639978 2004 [Cytochrome P450 2C19 gene polymorphism in 104 Chinese Zang volunteers].
15612662 2004 Genetic polymorphism analysis of cytochrome P4502C19 in Chinese Uigur and Han populations.
15608563 2004 Pharmacogenetics and herb-drug interactions: experience with Ginkgo biloba and omeprazole.
15590749 2005 Amitriptyline or not, that is the question: pharmacogenetic testing of CYP2D6 and CYP2C19 identifies patients with low or high risk for side effects in amitriptyline therapy.
15569425 2004 [Association between genetic polymorphisms of CYP2C19 and CYP2C9 and phenytoin serum concentration].
15499191 2004 A novel single nucleotide polymorphism (SNP) of the CYP2C19 gene in a Japanese subject with lowered capacity of mephobarbital 4'-hydroxylation.
15496639 2004 Effects of fluvoxamine on lansoprazole pharmacokinetics in relation to CYP2C19 genotypes.
15469410 2004 Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population.
15448955 2004 Pharmacokinetic differences between the enantiomers of lansoprazole and its metabolite, 5-hydroxylansoprazole, in relation to CYP2C19 genotypes.
15447734 2004 Omeprazole treatment of Korean patients: effects on gastric pH and gastrin release in relation to CYP2C19 geno- and phenotypes.
15385837 2004 Dosage recommendation of phenytoin for patients with epilepsy with different CYP2C9/CYP2C19 polymorphisms.
15385836 2004 Single oral dose pharmacokinetics of quazepam is influenced by CYP2C19 activity.
15371981 2004 CYP2C19 polymorphism is a major predictor of treatment failure in white patients by use of lansoprazole-based quadruple therapy for eradication of Helicobacter pylori.
15349706 2004 Fatal intoxication cases: cytochrome P450 2D6 and 2C19 genotype distributions.
15327595 2004 Genetic polymorphism of cytochrome P450 2C19 in healthy Malaysian subjects.
15301728 2004 Pharmacokinetics of lansoprazole in Chinese healthy subjects in relation to CYP2C19 genotypes.