Property Summary

NCBI Gene PubMed Count 40
PubMed Score 151.47
PubTator Score 97.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Protein-protein Interaction (2)

Gene RIF (14)

PMID Text
21798861 These results suggest that there is no notable influence of sequence variation in the CYP2C genes on longevity in the examined German population
20529763 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20045989 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19958090 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19706858 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19578179 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19038035 Despite the observed alterations, tg-CYP2C18&19 did not show any macroscopic or microscopic pathology at the examined age. Hence, these hemizygous transgenic mice were considered to be viable and healthy animals.
17048007 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFG      1 - 70
LKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRS     71 - 140
IEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSS    141 - 210
PWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQS    211 - 280
EFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDA    281 - 350
VVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFK    351 - 420
KSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV    421 - 490
//

Text Mined References (42)

PMID Year Title
23755828 2013 Genetic variants associated with warfarin dose in African-American individuals: a genome-wide association study.
21798861 2011 Genetic variation in the CYP2C monooxygenase enzyme subfamily shows no association with longevity in a German population.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20045989 2009 Influence of the genetic polymorphisms in the 5' flanking and exonic regions of CYP2C19 on proguanil oxidation.
19958090 2009 Genetic determinants of warfarin dosing in the Han-Chinese population.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19706858 2009 Association of cytochrome P450 2C19 genotype with the antiplatelet effect and clinical efficacy of clopidogrel therapy.
19578179 2009 A genome-wide association study of acenocoumarol maintenance dosage.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19038035 2008 Few alterations in clinical pathology and histopathology observed in a CYP2C18&19 humanized mice model.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17048007 2007 Association of warfarin dose with genes involved in its action and metabolism.
16963442 2006 Alloreactivity between disparate cognate and allogeneic pMHC-I complexes is the result of highly focused, peptide-dependent structural mimicry.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16359177 2005 P450 2C18 catalyzes the metabolic bioactivation of phenytoin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12694732 2003 Quantitation of cytochrome P450 mRNA levels in human skin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12378636 2002 Establishment of a transgenic cell line stably expressing human cytochrome P450 2C18 and identification of a CYP2C18 clone with exon 5 missing.
11093772 2000 Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites.
10768437 2000 Gene expression in distinct regions of the heart.
10704292 2000 The human CYP2C locus: a prototype for intergenic and exon repetition splicing events.
10487415 1999 Gene structure of CYP2C8 and extrahepatic distribution of the human CYP2Cs.
9890157 1998 Molecular genetics of the human cytochrome P450 monooxygenase superfamily.
9797707 1998 Characterisation of xenobiotic-metabolising enzyme expression in human bronchial mucosa and peripheral lung tissues.
9154796 1997 Exon skipping and circular RNA formation in transcripts of the human cytochrome P-450 2C18 gene in epidermis and of the rat androgen binding protein gene in testis.
9028867 1997 Targeted antipeptide antibodies to cytochrome P450 2C18 based on epitope mapping of an inhibitory monoclonal antibody to P450 2C51.
8333835 1993 Gene structure and upstream regulatory regions of human CYP2C9 and CYP2C18.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8110777 1994 Evidence that CYP2C19 is the major (S)-mephenytoin 4'-hydroxylase in humans.
8095407 1993 Cloning and expression of complementary DNAs for multiple members of the human cytochrome PH50IIC subfamily.
7704034 1994 Biochemistry and molecular biology of the human CYP2C subfamily.
2009263 1991 Cloning and expression of complementary DNAs for multiple members of the human cytochrome P450IIC subfamily.
1896026 1991 Polymerase chain reaction-directed identification, cloning, and quantification of human CYP2C18 mRNA.
1306110 1992 Partial sequence and polymerase chain reaction-mediated analysis of expression of the human CYP2C18 gene.