Property Summary

NCBI Gene PubMed Count 273
PubMed Score 5025.35
PubTator Score 1809.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.290 2.8e-04
pancreatic ductal adenocarcinoma liver m... -2.956 3.5e-03
lung cancer -1.600 1.1e-04
lung adenocarcinoma -1.200 3.3e-04
non primary Sjogren syndrome sicca -1.200 3.2e-02
lung carcinoma -4.100 1.3e-40
ulcerative colitis -1.800 3.4e-04
chronic rhinosinusitis -1.303 1.5e-02
psoriasis -1.100 3.5e-03

Protein-protein Interaction (4)

Gene RIF (279)

PMID Text
27015760 Report shift in substrate specificity with sequence element swaps between CYP2B6 and CYP2B11.
27010727 gene expression experiment revealed that CYP2B6, SPON1, and GSG1L can be activated concomitantly through a constitutive androstane receptor (CAR) activation pathway
26982502 Data suggest peripheral ligand-binding pocket and active site are located on opposite sides of the I-helix in CYP2B6; similar results were obtained for CYP2B4.
26681005 CYP2B6 516G>T SNP is prevalent in Aregntinian population.
26602960 Both Cyp2b6 CT/TT genotype of rs8192719 (c.1294 + 3C > T) and AG genotype of rs2279343 (c.785A > G) prolonged survival (p < 0.05).
26580670 the cytochrome P450 oxidoreductase g.6593A>G polymorphism significantly influences CYP2B6 activity
26544874 POR besides CYP2B6 can influence cyclophosphamide metabolism
26456622 Observation in Chinese patients with systemic lupus erythematosus indicated that the combination genetic marker of CYP2C19*2 and CYP2B6 -750 T > C genotypes was associated with 4-OH-CPA plasma concentration, short term efficacy and adverse reactions of cyclophosphamide.
26366873 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26319176 Functional importance of a peripheral pocket in mammalian cytochrome P450 2B enzymes.
26126958 Data suggest that primary cytochrome P450 in liver microsomes catalyzing 9-hydroxylation of (-)-cis- and (-)-trans-rose oxide is CYP2B6 (and CYP2C19 to some extent); rose oxide is aroma compound from essential oils and is used in food and perfume.
26107645 Average efavirenz concentrations of patients carrying ACTG (1.78 mug/mL), ACCT (7.50 mug/mL), and ATTG (1.92 mug/mL) haplotypes were markedly higher than those of patients carrying the CCTG haplotype.
26107207 CYP2B6 Gene Polymorphism is not associated with Acute Myeloid Leukemia.
26002734 Nine different metabolites of BDE-47 were produced by CYP2B6 via monooxygenase reactions that included aromatic hydroxylation, with and without an NIH-shift, dealkylation and debromination.
25933954 An increase in minor allele frequencies for CYP2B6 (and CYP2D6)was found in Roma population samples.
25839716 findings show that CYP2B6 is of importance for the metabolism of PCBs in humans, and may help to identify individuals who may be susceptible to PCB toxicity
25722197 Studied the extent to which CYP2B6 and NAT2 polymorphisms were associated increased efavirenz concentrations in black and Hispanic patients enrolled from sub-Saharan Africa and South America.
25702819 The CYP2B6*6 allele is associated with decrease plasma clearance and may be associated with a higher incidence of ketamine adverse effects.
25677220 significantly reduce the success of autologous HCT for lymphoma patients with the CYP2B6*5 variant.
25489907 8 SNPS and 7 variants were found. Reduced activity of the CYP2B6*6 variant was seen in nicotine-dependent individuals. The CYP2B6*1/*6 genotype was significantly associated with nicotine dependence.
25424204 Suggest that CYP2B6 rs707265 modified the risk of Hirschsprung disease in a Chinese population.
25409894 Data (including data from transgenic/knockout mice) suggest CYP2B6, in the absence of other xenobiotic monooxygenases CYP2A13 (coumarin 7-hydroxylase) and CYP2F1 (3-methylindole dehydrogenase), contributes to nicotine metabolism in liver microsomes.
25326287 Treatment with plasma from ANC28.1-treated blood suppressed CYP1A2, CYP2B6, and CYP3A4 activity.
25303294 CYP2B6*6, *11 and ABCB1 c.4036A>G genotypes were significant predictors of efavirenz plasma exposure.
25271170 The results provide evidence that the 516 TT homozygous genotype in the CYP2B6 gene presents a significant protective effect on the development of liver toxicity caused by anti-tuberculosis drugs.
24988984 differences in genetic variations and haplotypes of CYP2A6, CYP2B6, CYP2C8, and CYP2E1 were observed among ethnic populations.
24956253 The individualization of EFV dosage guided by genotyping 516G>T CYP2B6 and therapeutic drug monitoring could increase the efficiency of EFV use in antiretroviral treatment.
24885815 Circulating concentrations of the flame retardant BDE-47 were related to genetic variation in the CYP2B6 gene in an elderly population.
24832206 Both compounds increased CYP3A4 and CYP2B6 mRNA levels.
24831655 The effects of CYP2B6 516G>T (rs3745274) and smoking status on efavirenz plasma levels were established in a Serbian cohort.
24729586 Among individuals with a CYP2B6 slow metabolizer genotype, CYP2A6 and possibly UGT2B7 polymorphisms contribute to even higher efavirenz concentrations.
24695352 Virologic failures in HT 001 were not explained by polymorphisms in CYP2B6 and/or other genes known to define the lowest plasma efavirenz concentration stratum.
24586425 The involvement of the CYP2B6 polymorphism in AML susceptibility.
24562623 This is the first study to document the frequencies of the CYP2B6*4, *5, *6, *7, *9 alleles in the healthy Turkish individuals and our results could provide clinically useful information on drug metabolism by CYP2B6 in Turkish population.
24497997 Results indicate that higher mean AUC was attained in CYP2B6 *6/*6 genotypes compared to CYP2B6 *1/*1.
24488272 Interaction between metabolic rates of phytoestrogens and genetic polymorphisms of CYP2B6, CYP1A1, and NAT2 in male infertility.
24445070 Mutations R73 in P450 2B6 and R73, V216, L219, and F220 in 2B4 are important for catalytic efficiency.
24293093 CYP2B6 gene polymorphism G15631T has an effect on imatinib response in Moroccan chronic myeloid leukemia patients
24293076 The CYP2B6 T18492C polymorphism was significantly associated with lower efavirenz concentrations compared to those with homozygous wild type in HIV-1 infections.
24262967 The CYP2B6*6 allele influences the extent of weight reduction and pulse rate changes in patients undergoing sibutramine treatment.
24260284 The results indicate differences in mRNA expression and splicing as potential molecular mechanisms by which non-coding variation in CYP2B6 may affect enzymatic activity leading to differences in metabolism and smoking cessation.
24153159 CYP2B6 c.516G>T polymorphism may affect maximum blood concentrations of propofol in women.
24128861 This study investigated the possible impact of genetic variation in CYP2B6 on response to fludarabine chemotherapy in chronic lymphocytic leukemia.
24113184 HIV-1 gp120 upregulates the expression of cytochrome p450 family proteins CYP2E1, CYP2D6, and CYP2B6 in astrocytes
23970651 results suggested that CYP2B6 genotype was associated with different patterns of sleep problems
23886699 Inactivation of CYP2B6 by incubation with 10 muM RTV.
23846872 Genetic effect on both CYP2B6 protein expression and catalytic efficiency needs to be taken into account.
23837472 pharmacogenetic testing of CYP2B6 in HIV-infected patients offers evidence that this test can be used clinically to improve outcomes for patients receiving an efavirenz-based regimen.
23834474 Report expanded pharmacokinetic model that can be used to evaluate different dosing scenarios, during pregnancy, of drugs cleared by CYP2B6.
23824676 variations in CYP2B6 gene is associated with increased breast cancer risk.
23774940 CYP2B6 G516T and T983C single nucleotide polymorphisms were found to be associated with SJS/TEN susceptibility.
23746185 Eight CYP2B6/CYP2B7 diplotype combinations were found and a novel variant 769G>A (D257N) was discovered. The frequency of 785G corresponded to those reported for Caucasians and African-Americans.
23687222 The effects on plasma drug exposure following single-dose nevirapine may be greater for CYP2B6 983T --> C than for 516G --> T and are less pronounced than at steady state.
23615745 CYP2B6 and CYP2C9 polymorphisms seem to be associated with prasugrel low-response.
23591849 separated participants by CYP2B6 genotype into a high- vs. low-risk group to explore the contribution of nitrosamine activation to lung carcinogenesis
23550066 The results indicate a major role of CYP2B6 in ketamine N-demethylation in vitro and a significant impact of the CYP2B6*6 allele on enzyme-ketamine binding and catalytic activity.
23539296 Activation of the p38 MAPK pathway potentiates the induction of CYP2B6 mRNA by nuclear receptor CAR in hepatocytes.
23524664 Evaluation of the CYP2B6 polymorphism enabled prediction of the individual response to adjuvant mitotane treatment.
23418033 Because low-activity alleles of CYP2B6 are associated with impaired EFV metabolism and adverse drug response, these results are of potential utility for personalized treatment strategies in HIV/AIDS therapy
23399569 a polymorphism in the CYP2B6 gene is associated with higher plasma efavirenz concentations. These polymorphisms may have a predictive value over an efavirenz concentration that can lead to risk of adverse drug reaction in Tahi HIV-1 patients.
23344581 As HB is active and its steady-state concentrations are more than 10 times higher than bupropion, CYP2B6 variants are likely to affect pharmacological activity
23298916 CYP2B6 polymorphism in Malaysia is variable with trends that suggest an ethnic difference.
23288240 Letter: report PXR/CYP2B6 polymorphisms interact to impact methadone metabolism in treated heroin addicts.
23254426 pharmacogenetic markers of CYP2B6 have the greatest impact with respect to inducing low plasma efavirenz concentrations in HIV/TB Thai patients.
23249875 Genetic polymorphisms in CYP2B6 contribute toward explaining extreme (S)-methadone plasma levels observed in Opioid-Related Disorders
23238783 Report the influence of sex, ethnicity, and CYP2B6 genotype on bupropion metabolism as an index of hepatic CYP2B6 activity in humans.
22950382 The prevalence of CYP2B6-516G > T polymorphism in northern Thai population is high and strongly associated with inter-individual efavirenz levels variation.
22942317 The metabolic activation of tamoxifen in the CYP2B6 reconstituted system also resulted in the formation of an adduct to the P4502B6 apoprotein.
22936314 Selegiline increased the K(m) of CYP2B6 for bupropion from 10 to 92 muM.
22909231 Conformational adaptation of human cytochrome P450 2B6 and rabbit cytochrome P450 2B4 revealed upon binding multiple amlodipine molecules.
22815312 Data suggest that, during human pregnancy, the increasing estradiol concentrations will result in increased clearance of drugs that have CYP2B6-mediated clearance pathways.
22685215 Suggest that destruction of prosthetic heme is the underlying mechanism leading to the inactivation of CYP2B6 by methadone.
22680342 Influence of CYP2B6 ... SNPs on nevirapine plasma concentrations in Burundese HIV-positive patients
22519658 effect of metamizole on bupropion hydroxylation related to different CYP2B6 genotype groups
22471906 To investigate the frequency of CYP2B6 polymorphisms and the influence of haplotype structure on plasma efavirenz concentrations in Thai adults with HIV-1 infection
22462748 For both CYP2B6 and UGT2B7 genes, genetic variation was observed among individuals within populations, with the Papua New Guinean population showing the highest values for CYP2B6, and the Asian and European populations showing higher values for UGT2B7.
22397853 Tissue distribution of transgenic mRNA expression agrees well with the known respiratory tract-selective expression of CYP2A13 and CYP2F1 and hepatic expression of CYP2B6 in humans.
22281205 Data suggest that CYP2B6*6 has increased specific activity but reduced capacity to bioactivate the insecticide chlorpyrifos in liver microsomes compared to wild-type due to reduced hepatic protein expression.
22232427 The CYP2B6*6 allele is associated with altered binding affinity and/or catalytic activity.
21886015 large interethnic and intraethnic variability exists for CYP2B6 polymorphisms, thus reinforcing the need for tailored genotyping protocols for CYP2B6 testing as a biomarker of drug response.
21821736 Q172H gives inverse effects on metabolic activities of CYP2B6 affected by K262R.
21790905 The CYP2B6*6 allele [single nucleotide polymorphisms (SNPs) 785A>G (rs2279343) and 516G>T (rs3745274)] was associated with slow methadone metabolism.
21746968 Artemether demethylation activity was correlated with CYP2B6 protein levels (P = 0.004).
21741706 CYP2B6 genotype significantly influenced overall toxicity suggesting active CYP2B6 alleles led to higher rates of overall toxicity.
21715435 These data indicate that genetic variability in CYP2B6 and constitutive androstane receptor contributes to early treatment discontinuation for efavirenz-based antiretroviral regimens
21694616 Genetic polymorphisms in the CYP2B6 gene are indicators of the clearance, plasma concentration and concentration-to-dosage ratio of S-methadone.
21486104 The risk for fatal methadone-related intoxications may be higher in the context of benzodiazepine intoxication in slow metabolizers due to variation at the CYP2B6 gene the presence of an OPRM1 Asp40 allele.
21169260 Odds ratios for grade 3 and 4 hematologic toxicity in the treated group and hazard ratios for DFS associated with selected functional polymorphisms in CYP2B6,CYP3A4,GSTA1 and GSTP1 were estimated by logistic regression.
21158011 We suggest that the risk of methadone fatality may be predetermined in part by the CYP2B6*6 allele.
21156812 investigation of metabolism of ticlopidine by CYP2B6: identification of metabolites formed by recombinant CYP2B6
21108329 ultrarapid CYP2B6 metabolizers had worse PFS in patients receiving cyclophosphamide prior to myeloablative hematopoietic stem cell transplantation.(967-71)
20970553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20966044 constitutive androstane receptor (hCAR) mediated the CYP2B6 induction by cigarette smoke extract in Hep2G cells; data suggest that smoking up-regulates CYP2B6 through hCAR in vivo
20952418 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20952238 Analyzed potential rhabdomyolysis-susceptibility genes (RYR 1, CPT II, VLCAD and CYP 2D6) from autopsy samples of methamphetamine abusers; no obvious relationship between the genetic mutations observed in this study and rhabdomyolysis was seen.
20881953 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20878158 T allele of CYP2B6 516G>T SNP may be one of the risk factors predisposing to the pathogenesis of a majority of ALL and AML, but has no relationship with B-ALL and leukemia with or without chromosome abnormalities
20878158 Observational study of gene-disease association. (HuGE Navigator)
20876786 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20861742 distribution of SNPs in NR1I2, CYP3A4, CYP2B6 genes in white and sub-Saharan Africans with HIV; presence of NR1I2 polymorphisms can alter induction of CYP3A4 and CYP2B6 promoter, potentially adding to unpredictable nature of anti-HIV drug interactions
20861742 Observational study of gene-disease association. (HuGE Navigator)
20860463 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20841522 Trough efavirenz concentrations were significantly higher in patients with the 785 (A to G) and 516 (G to T) variants.
20841522 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20723261 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20720517 CYP2B6 (516 G>T) polymorphisms were associated with a significant decrease in EFV plasma clearance in 80% of the poor metabolizer patients
20720517 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20696882 Nevirapine clearance was shown to be affected by CYP2B6 516G>T genetic polymorphism and creatinine clearance, although this explained only part of the interpatient variability, which remains low compared to that for other antiretroviral drugs.
20696882 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20668445 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20662624 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20642445 Suggest that 1-aminobenzotriazole upregulates the expression of CYP2B6 and CYP3A4 potentially by constitutive androgen receptor activation.
20639527 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625352 CYP2B6 516 G>T was associated with high plasma efavirenz concentrations
20625352 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624854 This study demonstrates a synergistic interplay between a CYP2B6 polymorphism and pregnane X receptor-mediated induction.
20622021 CCAAT/enhancer-binding protein alpha (C/EBPalpha) and hepatocyte nuclear factor 4alpha (HNF4alpha) synergistically cooperate with constitutive androstane receptor to transactivate the human cytochrome P450 2B6 (CYP2B6) gene
20610889 Combination analysis of CYP2B6 and human leukocyte antigen (HLA) haplotypes revealed that individuals possessing CYP2B6*1H or *1J with HLA-A*3303 have the highest susceptibility to TP-induced hepatotoxicity.
20610889 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20583967 Report the concentration-dependent response and time-course for the induction of CYP2B6 by inducing agents beta-naphthoflavone, phenobarbital and rifampicin, respectively in two or more donors using multiple end-points.
20529763 Observational study of gene-disease association. (HuGE Navigator)
20517174 This study aimed to investigate whether 26 of the variant alleles of CYP2B6 (CYP2B6*2-CYP2B6*21 and CYP2B6*23-CYP2B6*28) affect its kinetics in the metabolism of 7-ethoxy-4-trifluoromethylcoumarin (7-EFC) and selegiline.
20459744 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20418888 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20361990 Data support the role of endosulfan-alpha as a strong activator of PXR and inducer of CYP2B6 and CYP3A4, which may impact metabolism of CYP2B6 or CYP3A4 substrates.
20350955 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20338069 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20307138 expression associated with genotype, gender, and exposure to inducers, but not with nicotine C-oxidation activity
20307138 Observational study of gene-disease association. (HuGE Navigator)
20179710 Variant alleles in the ABCB1, SLC22A16 and CYP2B6 genes are associated with response to AC therapy in the treatment of breast cancer.
20179710 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20137387 Genotypes of CYP2B6, GSTP1 and CYP2D6 are related to susceptibility to the metabolism of styrene in human.
20136364 Observational study of genetic testing. (HuGE Navigator)
20096935 Results indicate that residues in the C-helix of cytochrome P450 2B6 play a major role in the interaction with NADPH-cytochrome P450 reductase.
20089352 The presently evaluated variant alleles in the CYP2A6, CYP2B6, and CYP2C9 genes may explain part of the substantial variability in VPA pharmacokinetics between different subjects
20089352 Observational study of gene-disease association. (HuGE Navigator)
20079471 Reporter gene assays revealed that ERalpha and ERbeta increased CYP2B6-regulated gene expression through a functional ERE located at -1669 to -1657 in the upstream regulatory region of CYP2B6.
20017669 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19944064 the stabilizing effect of P334S in human cytochrome P450 2B6 and canine P450 2B11
19926050 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19916993 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19833192 This study provides the first demonstration of pregnane x receptor involvement in oltipraz transcriptional activation of CYP2B6 gene and of the inhibitory effect of oltipraz on CYP2B6 activity.
19812066 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19797611 The expression of UGT1A1 and CYP2B6 is negatively regulated through a CDK2 signaling pathway linked to cell cycle progression in HepG2 and SW480 cells, the mechanism of which may differ from that of CYP3A4 expression through PXR phosphorylated by CDK2.
19779319 findings demonstrate independent effects of CYP2A6 and UGT2B7 genetic variation on efavirenz disposition beyond that of the CYP2B6 polymorphisms.
19779319 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19704172 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19702527 the structure, function, regulation and polymorphism of CYP2B6 (Review)
19696793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19693007 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19682083 the CYP2B6*5 allele frequency among Spaniards was similar to that in other Caucasian or African groups, and higher than in Asians; the CYP2B6*5 allele frequency in Central Americans was lower than in Africans or Caucasian groups and higher than in Asians
19682083 Observational study of genotype prevalence. (HuGE Navigator)
19659438 Relatively frequent CYP2B6 polymorphisms may predict decreased plasma efavirenz exposure in patients of African descent.
19659438 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593168 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19531981 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19486190 The polymorphism was not more prevalent in individuals who had discontinued efavirenz and reasons for discontinuation are likely to be multifactorial and cannot be explained by this genetic difference alone.
19486190 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19474786 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19474465 CYP2B6-516G>T polymorphisms significantly affect the drug metabolism of efavirenz in children.
19474465 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19467232 ERG1 may loop the distal enhancer PB responsive enhancer module towards the proximal OA response element KI so that together, CAR and HNF4alpha synergistically activate the CYP2B6 promoter.
19464434 In microsomal preparations isolated from pediatric livers ranging from 10 weeks gestational age to 17 yrs, percentage of samples with detectable CYP2B6 increases with age from 64% in fetal samples to 95% in samples from donors more than 10 years of age.
19433561 Patients showing G/T and T/T CYP2B6 polymorphisms exhibited efavirenz clearances that were about 50% and 75% lower than those observed in the patients without these polymorphisms (G/G).
19433561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19425200 Lys262Arg polymorphism of the CYP2B6 gene may be a genetic marker for evaluating the risk of sporadic prostate cancer in native Japanese men
19425200 Observational study of gene-disease association. (HuGE Navigator)
19414633 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19376514 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19371316 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19282874 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19239339 Distribution of functional CYP2B haplotypes among HIV infected African American patients is significant different from that among control subjects.
19239339 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19228205 Cytochrome P450 2B6 516G-->T is associated with plasma concentrations of nevirapine at both 200 mg twice daily and 400 mg once daily in an ethnically diverse population
19228205 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19225447 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19218571 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19144407 CYP2B6 G15631T polymorphism is associated with acute leukemia susceptibility.
19144407 Observational study of gene-disease association. (HuGE Navigator)
19124658 CYP2B6 G516T polymorphism but not rifampin coadministrtion influences steady-state pharmacokinetics of efavirenz in human immunodeficiency virus-infected patients in South India.
19124658 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19106084 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19076156 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19005482 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18989234 The effect of efavirenz on bupropion hydroxylation as a marker of cytochrome P450 (CYP) 2B6 activity in healthy subjects is reported.
18989234 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18979093 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18978480 Observational study of genotype prevalence. (HuGE Navigator)
18854779 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18839779 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18784455 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18728241 results indicate that CYP2B6 genotype can to identify efavirenz poor metabolizers in TB/HIV con-infected patients co-treated with rifampin.
18728241 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18621926 Mechanisms underlying the differential effects of the K262R mutation of CYP2B6 are reported.
18496131 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18332083 ATF5 is abundant in the liver, activates CYP2B6, and cooperates with the constitutive androstane receptor in sustaining the hepatic-specific expression of this P450 in human hepatocytes and hepatoma cells.
18303024 CAR requires early growth response 1 to activate the human cytochrome P450 2B6 gene
18287571 S-bupropion hydroxylation and (S,S)-hydroxybupropion formation clearance may be a useful and improved phenotypic probe for CYP2B6
18281305 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18223457 Observational study of genotype prevalence. (HuGE Navigator)
18171905 the mechanism of the common *6 allele involves predominantly aberrant splicing, thus leading to reduced functional mRNA, protein, and activity.
18090046 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18057928 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18024866 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18004205 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18004205 CYP2B6 genetic variation is associated with the metabolism of nicotine and cotinine among individuals with decreased CYP2A6 activity
17918089 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17900275 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17885627 CYP2B6*29 represents a new mechanism of genetic variation at the CYP2B6 locus, underscoring the highly polymorphic nature of this isoenzyme.
17682072 Results show that 2-phenyl-2-(1-piperidinyl)propane (PPP) is a selective chemical inactivator of CYP2B6 and be used to define the role of CYP2B6 in the metabolism of drugs.
17654295 Clinical trial of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17638512 With over 100 described single nucleotide polymorphisms, numerous complex haplotypes and distinct ethnic frequencies, CYP2B6 is one of the most polymorphic CYP genes in humans.
17559344 CYP2B6 polymorphism markedly influences the metabolism of efavirenz in human liver microsomes and represents a first step toward elucidating the mechanism by which this allele identifies patients exhibiting very high efavirenz plasma concentrations.
17502835 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17502835 single nucleotide polymorphisms in the promoter region or introns in the CYP2B6 affect the potency of cyclophosphamide activation to 4-hydroxycyclophosphamide
17465455 Observational study of genotype prevalence. (HuGE Navigator)
17465455 Results document the spectrum of CYP2B6 allelic variants and genotypes in a southern Chinese population. The 516G > T allele is associated with a defective metabolism of efavirenz (EFV), which therefore may predispose to drug toxicity.
17455229 Decreased expression of CYP2B6 might play a role in the development of prostate cancer, and be useful as the prognostic predictor for human prostate cancer.
17407229 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17391322 Observational study of genotype prevalence. (HuGE Navigator)
17391322 Significant interethnic differences occur at the CYP2B6 locus, which may influence treatment outcomes with efavirenz.
17356468 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17356468 CYP2B6-G516T polymorphisms significantly affect the CL/F rate of EFV in children.
17352764 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17329992 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17235330 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17223085 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17178267 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17054410 the reliable and quick Pyrosequencing assay affords facilitated future research on the importance of CYP2B6
17047492 Clinical trial of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17015050 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16951995 Observational study of genotype prevalence. (HuGE Navigator)
16912957 Observational study of gene-disease association. (HuGE Navigator)
16815693 Observational study of genotype prevalence. (HuGE Navigator)
16772608 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16623664 SMC1 binding represses OARE [OA (okadaic acid) response element] activity and its dissociation allows the recruitment of CAR(constitutive active/androstane receptor) to the OARE, synergizing the expression of the CYP2B6 gene.
16538176 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16506047 Observational study of genotype prevalence. (HuGE Navigator)
16506047 CYP2B6 variants, previously shown to affect metabolism of a variety of drugs, occur in West Africa and Papua New Guinea, and there are significant genetic differences at the CYP2B6 locus in these populations
16495778 a novel specific CYP2B6 allele in Africans causes impaired metabolism of the HIV drug efavirenz
16433869 Observational study of gene-disease association. (HuGE Navigator)
16392089 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16338275 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16338275 CYP2B6 genotype influences (S)-methadone and, to a lesser extent, (R)-methadone plasma levels.
16267764 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16183265 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16125881 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16116487 Observational study of gene-disease association. (HuGE Navigator)
15864119 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15864119 CYP2B6 polymorphism has a role in plasma and intracellular concentrations and toxicity of efavirenz and nevirapine in HIV-infected patients
15825040 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15622315 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15572372 AMPK has a role in the phenobarbital induction of CYP2B gene expression
15563456 The two cis-acting elements, the distal PBREM and the proximal OARE, within the chromatin structure are both regulated by CAR in response to okadaic acid and TCPOBOP to maximally induce the CYP2B6 promoter.
15383491 Observational study of genotype prevalence. (HuGE Navigator)
15284537 Observational study of gene-disease association. (HuGE Navigator)
15248218 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15194512 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15194512 Data show that the mean plasma efavirenz concentration of HIV-1 patients homozygous for CYP2B6 *6/*6 (Q172H and K262R) was significantly higher than that of patients heterozygous for *6 or without alleles *6.
15178651 Observational study of genetic testing. (HuGE Navigator)
14977870 CYP2B6 is highly inducible by known CYP3A4 inducers and suggest that human pregnane X receptor is a major determinant of CYP2B6-inducible expression
14515060 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12738724 Down-regulation of cytochrome P450 CYP2B6 is associated with breast cancer
12629583 Observational study of gene-disease association. (HuGE Navigator)
12571232 a novel xenobiotic-responsive enhancer module in the distal region of the CYP2B6 promoter (CYP2B6-XREM) together with the PBREM mediates optimal drug-induced expression of CYP2B6
12490624 substitution of residue 363 in CYP2B6 resulted in significant alterations of the metabolite profile for the side chain hydroxylation of 7-butoxycoumarin
12439223 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12242601 Observational study of genotype prevalence. (HuGE Navigator)
12207635 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11991950 expression in hepatocytes by vitamin D receptor pathway
11470993 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11243870 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHL      1 - 70
GPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKR     71 - 140
SVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLIS    141 - 210
SVFGQLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAH    211 - 280
SEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTE    281 - 350
AVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL    351 - 420
KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTYQIRFLP    421 - 490
R//

Text Mined References (278)

PMID Year Title
27015760 2016 Ordered chimerogenesis applied to CYP2B P450 enzymes.
27010727 2016 Genome-Wide Pharmacogenomic Study on Methadone Maintenance Treatment Identifies SNP rs17180299 and Multiple Haplotypes on CYP2B6, SPON1, and GSG1L Associated with Plasma Concentrations of Methadone R- and S-enantiomers in Heroin-Dependent Patients.
26982502 2016 Coumarin Derivatives as Substrate Probes of Mammalian Cytochromes P450 2B4 and 2B6: Assessing the Importance of 7-Alkoxy Chain Length, Halogen Substitution, and Non-Active Site Mutations.
26681005 2015 Prevalence of CYP2B6 polymorphisms in Argentinians: the role of genetic testing.
26602960 2015 The prognostic values of CYP2B6 genetic polymorphisms and metastatic sites for advanced breast cancer patients treated with docetaxel and thiotepa.
26544874 2015 Cytochrome P450 Oxidoreductase Influences CYP2B6 Activity in Cyclophosphamide Bioactivation.
26456622 2016 Genetic markers in CYP2C19 and CYP2B6 for prediction of cyclophosphamide's 4-hydroxylation, efficacy and side effects in Chinese patients with systemic lupus erythematosus.
26366873 2015 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26319176 2015 Functional importance of a peripheral pocket in mammalian cytochrome P450 2B enzymes.
26126958 2015 Metabolism of (-)-cis- and (-)-trans-rose oxide by cytochrome P450 enzymes in human liver microsomes.
26107645 2015 Effect of CYP2B6 Gene Polymorphisms on Efavirenz Plasma Concentrations in Chinese Patients with HIV Infection.
26107207 2015 Prognostic Value of a CYP2B6 Gene Polymorphism in Patients with Acute Myeloid Leukemia.
26002734 2015 Regioselective Versatility of Monooxygenase Reactions Catalyzed by CYP2B6 and CYP3A4: Examples with Single Substrates.
25933954 2015 Increased prevalence of functional minor allele variants of drug metabolizing CYP2B6 and CYP2D6 genes in Roma population samples.
25839716 2015 Genome-wide association study of plasma levels of polychlorinated biphenyls disclose an association with the CYP2B6 gene in a population-based sample.
25722197 2015 Combined effect of CYP2B6 and NAT2 genotype on plasma efavirenz exposure during rifampin-based antituberculosis therapy in the STRIDE study.
25702819 2015 CYP2B6*6 allele and age substantially reduce steady-state ketamine clearance in chronic pain patients: impact on adverse effects.
25677220 2015 Cytochrome P450 2B6*5 Increases Relapse after Cyclophosphamide-Containing Conditioning and Autologous Transplantation for Lymphoma.
25489907 2015 CYP2B6 gene single-nucleotide polymorphisms in an Italian population sample and relationship with nicotine dependence.
25424204 2015 Associations Between CYP2B6 rs707265, rs1042389, rs2054675, and Hirschsprung Disease in a Chinese Population.
25409894 2015 Characterization of CYP2B6 in a CYP2B6-humanized mouse model: inducibility in the liver by phenobarbital and dexamethasone and role in nicotine metabolism in vivo.
25326287 2015 Anti-CD28 monoclonal antibody-stimulated cytokines released from blood suppress CYP1A2, CYP2B6, and CYP3A4 in human hepatocytes in vitro.
25303294 2014 CYP2B6 genotype, but not rifampicin-based anti-TB cotreatments, explains variability in long-term efavirenz plasma exposure.
25271170 2015 Association of the CYP2B6 gene with anti-tuberculosis drug-induced hepatotoxicity in a Brazilian Amazon population.
24988984 2015 Direct sequencing and comprehensive screening of genetic polymorphisms on CYP2 family genes (CYP2A6, CYP2B6, CYP2C8, and CYP2E1) in five ethnic populations.
24956253 2014 Dose reduction of efavirenz: an observational study describing cost-effectiveness, pharmacokinetics and pharmacogenetics.
24885815 2014 Genetic variation in the CYP2B6 gene is related to circulating 2,2',4,4'-tetrabromodiphenyl ether (BDE-47) concentrations: an observational population-based study.
24832206 2014 Interactions of endosulfan and methoxychlor involving CYP3A4 and CYP2B6 in human HepaRG cells.
24831655 2014 CYP2B6 516G>T (rs3745274) and smoking status are associated with efavirenz plasma concentration in a Serbian cohort of HIV patients.
24729586 2014 Secondary metabolism pathway polymorphisms and plasma efavirenz concentrations in HIV-infected adults with CYP2B6 slow metabolizer genotypes.
24695352 2014 Functional CYP2B6 variants and virologic response to an efavirenz-containing regimen in Port-au-Prince, Haiti.
24586425 2014 The G?¹?T CYP2B6 germline polymorphism affects the risk of acute myeloid leukemia and is associated with specific chromosomal abnormalities.
24562623 2014 Allele and genotype frequencies of CYP2B6 in a Turkish population.
24497997 2014 Pharmacogenetic-based efavirenz dose modification: suggestions for an African population and the different CYP2B6 genotypes.
24488272 2014 Combined effects of urinary phytoestrogens metabolites and polymorphisms in metabolic enzyme gene on idiopathic male infertility.
24445070 2014 The role of cytochrome P450 2B6 and 2B4 substrate access channel residues predicted based on crystal structures of the amlodipine complexes.
24293093 2014 Functional polymorphism of CYP2B6 G15631T is associated with hematologic and cytogenetic response in chronic myeloid leukemia patients treated with imatinib.
24293076 2014 Low level of efavirenz in HIV-1-infected Thai adults is associated with the CYP2B6 polymorphism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24262967 2014 Effects of CYP3A5, CYP2C19, and CYP2B6 on the clinical efficacy and adverse outcomes of sibutramine therapy: a crucial role for the CYP2B6*6 allele.
24260284 2013 CYP2B6 non-coding variation associated with smoking cessation is also associated with differences in allelic expression, splicing, and nicotine metabolism independent of common amino-acid changes.
24153159 2014 Association of the CYP2B6 c.516G>T polymorphism with high blood propofol concentrations in women from northern Greece.
24128861 2013 CYP2B6*6 is an independent determinant of inferior response to fludarabine plus cyclophosphamide in chronic lymphocytic leukemia.
23970651 2014 Sleep quality in efavirenz-treated Chinese HIV patients - comparing between GT and GG genotype of CYP2B6-516 G/T polymorphisms.
23886699 2013 The effect of ritonavir on human CYP2B6 catalytic activity: heme modification contributes to the mechanism-based inactivation of CYP2B6 and CYP3A4 by ritonavir.
23846872 2013 CYP2B6 pharmacogenetics-based in vitro-in vivo extrapolation of efavirenz clearance by physiologically based pharmacokinetic modeling.
23837472 2013 Would a CYP2B6 test help HIV patients being treated with efavirenz?
23834474 2014 Expansion of a PBPK model to predict disposition in pregnant women of drugs cleared via multiple CYP enzymes, including CYP2B6, CYP2C9 and CYP2C19.
23824676 2014 CYP2B6*6 is associated with increased breast cancer risk.
23774940 2013 Association between CYP2B6 polymorphisms and Nevirapine-induced SJS/TEN: a pharmacogenetics study.
23746185 2013 High-resolution melt analysis to detect sequence variations in highly homologous gene regions: application to CYP2B6.
23687222 2013 Clinical and genetic determinants of plasma nevirapine exposure following an intrapartum dose to prevent mother-to-child HIV transmission.
23615745 2013 Cytochrome P450 2B6 and 2C9 genotype polymorphism--a possible cause of prasugrel low responsiveness.
23591849 2013 Pilot study of CYP2B6 genetic variation to explore the contribution of nitrosamine activation to lung carcinogenesis.
23550066 2013 The CYP2B6*6 allele significantly alters the N-demethylation of ketamine enantiomers in vitro.
23539296 2013 p38 Mitogen-activated protein kinase regulates nuclear receptor CAR that activates the CYP2B6 gene.
23524664 2013 Influence of the CYP2B6 polymorphism on the pharmacokinetics of mitotane.
23418033 2013 Novel CYP2B6 enzyme variants in a Rwandese population: functional characterization and assessment of in silico prediction tools.
23399569 2013 High plasma efavirenz concentration and CYP2B6 polymorphisms in Thai HIV-1 infections.
23344581 2013 Influence of CYP2B6 genetic variants on plasma and urine concentrations of bupropion and metabolites at steady state.
23298916 Haplotypes frequencies of CYP2B6 in Malaysia.
23288240 2013 PXR polymorphisms interacted with CYP2B6 polymorphisms on methadone metabolites.
23254426 2013 Impact of pharmacogenetic markers of CYP2B6, clinical factors, and drug-drug interaction on efavirenz concentrations in HIV/tuberculosis-coinfected patients.
23249875 2013 Contribution of CYP2B6 alleles in explaining extreme (S)-methadone plasma levels: a CYP2B6 gene resequencing study.
23238783 2013 The influence of sex, ethnicity, and CYP2B6 genotype on bupropion metabolism as an index of hepatic CYP2B6 activity in humans.
22950382 2012 Correlation of CYP2B6-516G > T Polymorphism with Plasma Efavirenz Concentration and Depression in HIV-Infected Adults in Northern Thailand.
22942317 2012 Bioactivation of the cancer chemopreventive agent tamoxifen to quinone methides by cytochrome P4502B6 and identification of the modified residue on the apoprotein.
22936314 2012 Inhibition of bupropion metabolism by selegiline: mechanism-based inactivation of human CYP2B6 and characterization of glutathione and peptide adducts.
22909231 2012 Conformational adaptation of human cytochrome P450 2B6 and rabbit cytochrome P450 2B4 revealed upon binding multiple amlodipine molecules.
22815312 2013 Quantitative prediction of CYP2B6 induction by estradiol during pregnancy: potential explanation for increased methadone clearance during pregnancy.
22685215 2012 Mechanism-based inactivation of cytochrome P450 2B6 by methadone through destruction of prosthetic heme.
22680342 2012 Influence of CYP2B6 and ABCB1 SNPs on nevirapine plasma concentrations in Burundese HIV-positive patients using dried sample spot devices.
22519658 2012 Rapid clinical induction of bupropion hydroxylation by metamizole in healthy Chinese men.
22471906 2012 Pharmacogenetic markers of CYP2B6 associated with efavirenz plasma concentrations in HIV-1 infected Thai adults.
22462748 2012 Worldwide variation in human drug-metabolism enzyme genes CYP2B6 and UGT2B7: implications for HIV/AIDS treatment.
22397853 2012 Generation and characterization of a CYP2A13/2B6/2F1-transgenic mouse model.
22281205 2012 Effect of CYP2B6*6 and CYP2C19*2 genotype on chlorpyrifos metabolism.
22232427 2012 Effects of the CYP2B6*6 allele on catalytic properties and inhibition of CYP2B6 in vitro: implication for the mechanism of reduced efavirenz metabolism and other CYP2B6 substrates in vivo.
21886015 2011 Cytochrome P450 CYP2B6 genotypes and haplotypes in a Colombian population: identification of novel variant CYP2B6 alleles.
21875942 2011 Structures of cytochrome P450 2B6 bound to 4-benzylpyridine and 4-(4-nitrobenzyl)pyridine: insight into inhibitor binding and rearrangement of active site side chains.
21821736 2011 Q172H replacement overcomes effects on the metabolism of cyclophosphamide and efavirenz caused by CYP2B6 variant with Arg262.
21790905 2013 CYP2B6 SNPs are associated with methadone dose required for effective treatment of opioid addiction.
21746968 2011 Functional characterization of CYP2B6 allelic variants in demethylation of antimalarial artemether.
21741706 2012 Correlation of CYP2B6, CYP2C19, ABCC4 and SOD2 genotype with outcomes in allogeneic blood and marrow transplant patients.
21715435 2011 Cytochrome P450 2B6 (CYP2B6) and constitutive androstane receptor (CAR) polymorphisms are associated with early discontinuation of efavirenz-containing regimens.
21694616 2011 CYP2B6 polymorphisms influence the plasma concentration and clearance of the methadone S-enantiomer.
21486104 2011 The World Federation of Societies of Biological Psychiatry (WFSBP) guidelines for the biological treatment of substance use and related disorders. Part 2: Opioid dependence.
21169260 2010 Gene polymorphisms in cyclophosphamide metabolism pathway,treatment-related toxicity, and disease-free survival in SWOG 8897 clinical trial for breast cancer.
21158011 2011 CYP2B6 and OPRM1 gene variations predict methadone-related deaths.
21156812 2011 Comparison of in vitro metabolism of ticlopidine by human cytochrome P450 2B6 and rabbit cytochrome P450 2B4.
21108329 2010 Allelic variations in CYP2B6 and CYP2C19 and survival of patients receiving cyclophosphamide prior to myeloablative hematopoietic stem cell transplantation.
20970553 2010 Toward personalized medicine in renal transplantation.
20966044 2011 Cigarette smoke extract induces CYP2B6 through constitutive androstane receptor in hepatocytes.
20952418 2010 Tribal ethnicity and CYP2B6 genetics in Ugandan and Zimbabwean populations in the UK: implications for efavirenz dosing in HIV infection.
20952238 2011 Genetic analysis of the rhabdomyolysis-associated genes in forensic autopsy cases of methamphetamine abusers.
20881953 2010 Long-term efavirenz autoinduction and its effect on plasma exposure in HIV patients.
20878158 2011 CYP2B6 gene single nucleotide polymorphisms and leukemia susceptibility.
20876786 2011 Effects of pregnane X receptor (NR1I2) and CYP2B6 genetic polymorphisms on the induction of bupropion hydroxylation by rifampin.
20861742 2010 Nuclear receptor-mediated induction of CYP450 by antiretrovirals: functional consequences of NR1I2 (PXR) polymorphisms and differential prevalence in whites and sub-Saharan Africans.
20860463 2010 Influence of host genetic factors on efavirenz plasma and intracellular pharmacokinetics in HIV-1-infected patients.
20841522 2010 Efavirenz plasma concentrations and cytochrome 2B6 polymorphisms.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20723261 2010 Presence of the CYP2B6 516G> T polymorphism, increased plasma Efavirenz concentrations and early neuropsychiatric side effects in South African HIV-infected patients.
20720517 2010 The convergence of therapeutic drug monitoring and pharmacogenetic testing to optimize efavirenz therapy.
20696882 2010 Population pharmacokinetic-pharmacogenetic study of nevirapine in HIV-infected Cambodian patients.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20668445 2010 OPRM1 and CYP2B6 gene variants as risk factors in methadone-related deaths.
20662624 2010 Effect of CYP2B6, ABCB1, and CYP3A5 polymorphisms on efavirenz pharmacokinetics and treatment response: an AIDS Clinical Trials Group study.
20642445 2010 Induction of CYP2B6 and CYP3A4 expression by 1-aminobenzotriazole (ABT) in human hepatocytes.
20639527 2010 Haplotype structure of CYP2B6 and association with plasma efavirenz concentrations in a Chilean HIV cohort.
20625352 2010 CYP2B6 polymorphism and nonnucleoside reverse transcriptase inhibitor plasma concentrations in Chinese HIV-infected patients.
20624854 2010 Synergistically enhanced CYP2B6 inducibility between a polymorphic mutation in CYP2B6 promoter and pregnane X receptor activation.
20622021 2010 CCAAT/enhancer-binding protein alpha (C/EBPalpha) and hepatocyte nuclear factor 4alpha (HNF4alpha) synergistically cooperate with constitutive androstane receptor to transactivate the human cytochrome P450 2B6 (CYP2B6) gene: application to the development of a metabolically competent human hepatic cell model.
20610889 2010 Enhanced susceptibility of HLA-mediated ticlopidine-induced idiosyncratic hepatotoxicity by CYP2B6 polymorphism in Japanese.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20583967 2010 A multi-endpoint evaluation of cytochrome P450 1A2, 2B6 and 3A4 induction response in human hepatocyte cultures after treatment with ?-naphthoflavone, phenobarbital and rifampicin.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20517174 2010 Functional characterization of 26 CYP2B6 allelic variants (CYP2B6.2-CYP2B6.28, except CYP2B6.22).
20459744 2010 Cyclophosphamide-metabolizing enzyme polymorphisms and survival outcomes after adjuvant chemotherapy for node-positive breast cancer: a retrospective cohort study.
20418888 2010 Sequence variants at CHRNB3-CHRNA6 and CYP2A6 affect smoking behavior.
20361990 2010 Endosulfan induces CYP2B6 and CYP3A4 by activating the pregnane X receptor.
20350955 2011 Effect of CYP2B6 genotype on the pharmacokinetics of sibutramine and active metabolites in healthy subjects.
20338069 2010 Effects of CYP2B6 G516T polymorphisms on plasma efavirenz and nevirapine levels when co-administered with rifampicin in HIV/TB co-infected Thai adults.
20307138 2010 Hepatic CYP2B6 is altered by genetic, physiologic, and environmental factors but plays little role in nicotine metabolism.
20179710 2010 Influence of pharmacogenetics on response and toxicity in breast cancer patients treated with doxorubicin and cyclophosphamide.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20137387 2009 [Association between CYP2B6, CYP2D6, GSTP1 genetic polymorphisms and urinary styrene metabolites in professional workers].
20136364 2010 Errors and reproducibility of DNA array-based detection of allelic variants in ADME genes: PHARMAchip.
20096935 2010 Cross-linking of human cytochrome P450 2B6 to NADPH-cytochrome P450 reductase: Identification of a potential site of interaction.
20089352 2010 The influence of cytochrome oxidase CYP2A6, CYP2B6, and CYP2C9 polymorphisms on the plasma concentrations of valproic acid in epileptic patients.
20079471 Estrogen receptor-dependent regulation of CYP2B6 in human breast cancer cells.
20061448 2010 Crystal structure of a cytochrome P450 2B6 genetic variant in complex with the inhibitor 4-(4-chlorophenyl)imidazole at 2.0-A resolution.
20017669 2010 Nevirapine-induced hepatotoxicity and pharmacogenetics: a retrospective study in a population from Mozambique.
19944064 2010 Rational engineering of cytochromes P450 2B6 and 2B11 for enhanced stability: Insights into structural importance of residue 334.
19926050 2009 Pharmacogenetic testing for clopidogrel using the rapid INFINITI analyzer: a dose-escalation study.
19916993 2009 A novel polymorphism in ABCB1 gene, CYP2B6*6 and sex predict single-dose efavirenz population pharmacokinetics in Ugandans.
19833192 2010 Involvement of pregnane X receptor in the regulation of CYP2B6 gene expression by oltipraz in human hepatocytes.
19812066 2009 Influence of CYP2B6 polymorphisms on the persistence of plasma nevirapine concentrations following a single intra-partum dose for the prevention of mother to child transmission in HIV-infected Thai women.
19797611 2010 Induction of UGT1A1 and CYP2B6 by an antimitogenic factor in HepG2 cells is mediated through suppression of cyclin-dependent kinase 2 activity: cell cycle-dependent expression.
19779319 2009 CYP2B6, CYP2A6 and UGT2B7 genetic polymorphisms are predictors of efavirenz mid-dose concentration in HIV-infected patients.
19704172 2009 Effect of rifampicin-based antitubercular therapy and the cytochrome P450 2B6 516G>T polymorphism on efavirenz concentrations in adults in South Africa.
19702527 2009 Substrate specificity, regulation, and polymorphism of human cytochrome P450 2B6.
19696793 2009 Association study of genetic polymorphism in ABCC4 with cyclophosphamide-induced adverse drug reactions in breast cancer patients.
19693007 2009 Association of CYP2B6, CYP3A5, and CYP2C19 genetic polymorphisms with sibutramine pharmacokinetics in healthy Korean subjects.
19682083 2010 Haplotype structure and allele frequencies of CYP2B6 in Spaniards and Central Americans.
19659438 2009 CYP2B6 variants and plasma efavirenz concentrations during antiretroviral therapy in Port-au-Prince, Haiti.
19651758 2009 Hepatic cytochrome P450 enzyme alterations in humans with progressive stages of nonalcoholic fatty liver disease.
19593168 2009 ABCB1 and cytochrome P450 polymorphisms: clinical pharmacogenetics of clozapine.
19531981 2009 Pharmacokinetics of plasma efavirenz and CYP2B6 polymorphism in southern Chinese.
19486190 2009 CYP2B6 G516T genotyping in a UK cohort of HIV-positive patients: polymorphism frequency and influence on efavirenz discontinuation.
19474786 2009 The relationships of ABCB1 3435C>T and CYP2B6 516G>T with high-density lipoprotein cholesterol in HIV-infected patients receiving Efavirenz.
19474465 2009 Plasma efavirenz concentrations and the association with CYP2B6-516G >T polymorphism in HIV-infected Thai children.
19467232 2009 Early growth response 1 loops the CYP2B6 promoter for synergistic activation by the distal and proximal nuclear receptors CAR and HNF4alpha.
19464434 2009 Human hepatic CYP2B6 developmental expression: the impact of age and genotype.
19433561 2009 Influence of the cytochrome P450 2B6 genotype on population pharmacokinetics of efavirenz in human immunodeficiency virus patients.
19425200 2009 Polymorphism of cytochrome P450 2B6 and prostate cancer risk: a significant association in a Japanese population.
19414633 2009 Cytochrome P450 genetic polymorphisms and the response to prasugrel: relationship to pharmacokinetic, pharmacodynamic, and clinical outcomes.
19376514 2010 Association of cyclophosphamide drug-metabolizing enzyme polymorphisms and chemotherapy-related ovarian failure in breast cancer survivors.
19371316 2009 CYP2B6 (c.516G-->T) and CYP2A6 (*9B and/or *17) polymorphisms are independent predictors of efavirenz plasma concentrations in HIV-infected patients.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
19282874 2009 A pharmacogenetic study of CD4 recovery in response to HIV antiretroviral therapy in two South African population groups.
19239339 2009 Associations between CYP2B6 polymorphisms and pharmacokinetics after a single dose of nevirapine or efavirenz in African americans.
19228205 2009 Cytochrome P450 2B6 516G-->T is associated with plasma concentrations of nevirapine at both 200 mg twice daily and 400 mg once daily in an ethnically diverse population.
19225447 2009 Pharmacogenetics-based population pharmacokinetic analysis of efavirenz in HIV-1-infected individuals.
19218571 2009 Association of high T allele frequency of CYP2B6 G516T polymorphism among ethnic south Indian HIV-infected patients with elevated plasma efavirenz and nevirapine.
19144407 2009 Association of CYP2B6 G15631T polymorphism with acute leukemia susceptibility.
19124658 2009 CYP2B6 G516T polymorphism but not rifampin coadministration influences steady-state pharmacokinetics of efavirenz in human immunodeficiency virus-infected patients in South India.
19106084 2009 Cytochrome p-450 polymorphisms and response to clopidogrel.
19076156 2009 Polymorphisms of drug-metabolizing enzymes (GST, CYP2B6 and CYP3A) affect the pharmacokinetics of thiotepa and tepa.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19029318 2009 Comprehensive in vitro analysis of voriconazole inhibition of eight cytochrome P450 (CYP) enzymes: major effect on CYPs 2B6, 2C9, 2C19, and 3A.
19005482 2009 Association of drug metabolism gene polymorphisms with toxicities, graft-versus-host disease and survival after HLA-identical sibling hematopoietic stem cell transplantation for patients with leukemia.
18989234 2008 Efavirenz induces CYP2B6-mediated hydroxylation of bupropion in healthy subjects.
18979093 2009 Pharmacogenomics of CYP2A6, CYP2B6, CYP2C19, CYP2D6, CYP3A4, CYP3A5 and MDR1 in Vietnam.
18978480 2008 Slow efavirenz metabolism genotype is common in Botswana.
18854779 2008 Relations between polymorphisms in drug-metabolising enzymes and toxicity of chemotherapy with cyclophosphamide, thiotepa and carboplatin.
18839779 2008 A pharmacokinetic and pharmacogenetic study of efavirenz in children: dosing guidelines can result in subtherapeutic concentrations.
18784455 2008 The pharmacokinetics and pharmacogenomics of efavirenz and lopinavir/ritonavir in HIV-infected persons requiring hemodialysis.
18728241 2008 Pharmacokinetics of efavirenz when co-administered with rifampin in TB/HIV co-infected patients: pharmacogenetic effect of CYP2B6 variation.
18621926 2008 Investigation of the mechanisms underlying the differential effects of the K262R mutation of P450 2B6 on catalytic activity.
18496131 2008 Influence of polymorphisms of drug metabolizing enzymes (CYP2B6, CYP2C9, CYP2C19, CYP3A4, CYP3A5, GSTA1, GSTP1, ALDH1A1 and ALDH3A1) on the pharmacokinetics of cyclophosphamide and 4-hydroxycyclophosphamide.
18356043 2008 Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone.
18332083 2008 ATF5 is a highly abundant liver-enriched transcription factor that cooperates with constitutive androstane receptor in the transactivation of CYP2B6: implications in hepatic stress responses.
18303024 2008 Nuclear receptor CAR requires early growth response 1 to activate the human cytochrome P450 2B6 gene.
18287571 2008 Stereoselective bupropion hydroxylation as an in vivo phenotypic probe for cytochrome P4502B6 (CYP2B6) activity.
18281305 2008 Impact of CYP2B6 983T>C polymorphism on non-nucleoside reverse transcriptase inhibitor plasma concentrations in HIV-infected patients.
18223457 2008 Polymorphism of antimalaria drug metabolizing, nuclear receptor, and drug transport genes among malaria patients in Zanzibar, East Africa.
18171905 2008 Aberrant splicing caused by single nucleotide polymorphism c.516G>T [Q172H], a marker of CYP2B6*6, is responsible for decreased expression and activity of CYP2B6 in liver.
18090046 2007 CYP2B6 genetic variants are associated with nevirapine pharmacokinetics and clinical response in HIV-1-infected children.
18057928 2008 High prevalence of the CYP2B6 516G-->T(*6) variant and effect on the population pharmacokinetics of efavirenz in HIV/AIDS outpatients in Zimbabwe.
18024866 2007 Breast cancer treatment outcome with adjuvant tamoxifen relative to patient CYP2D6 and CYP2C19 genotypes.
18004205 2007 Gene-gene interactions between CYP2B6 and CYP2A6 in nicotine metabolism.
17918089 2007 Successful efavirenz dose reduction in HIV type 1-infected individuals with cytochrome P450 2B6 *6 and *26.
17900275 2007 Common polymorphisms of CYP2C19 and CYP2C9 affect the pharmacokinetic and pharmacodynamic response to clopidogrel but not prasugrel.
17885627 2007 Partial deletion of CYP2B6 owing to unequal crossover with CYP2B7.
17682072 2007 A comparison of 2-phenyl-2-(1-piperidinyl)propane (ppp), 1,1',1''-phosphinothioylidynetrisaziridine (thioTEPA), clopidogrel, and ticlopidine as selective inactivators of human cytochrome P450 2B6.
17654295 2007 Pharmacogenetic clinical trial of sustained-release bupropion for smoking cessation.
17638512 2007 Polymorphic CYP2B6: molecular mechanisms and emerging clinical significance.
17559344 2007 Impact of CYP2B6 polymorphism on hepatic efavirenz metabolism in vitro.
17502835 2007 Genetic polymorphisms of CYP2B6 affect the pharmacokinetics/pharmacodynamics of cyclophosphamide in Japanese cancer patients.
17465455 2007 Genetic variability of CYP2B6 polymorphisms in four southern Chinese populations.
17455229 2007 Cytochrome P450 2B6 is a growth-inhibitory and prognostic factor for prostate cancer.
17407229 2007 Cytochrome P450 polymorphism as a predictor of ovarian toxicity to pulse cyclophosphamide in systemic lupus erythematosus.
17391322 2007 CYP2B6 983T>C polymorphism is prevalent in West Africa but absent in Papua New Guinea: implications for HIV/AIDS treatment.
17356468 2007 Efavirenz pharmacokinetics in HIV-1-infected children are associated with CYP2B6-G516T polymorphism.
17352764 2007 Cytochrome P450 2B6 (CYP2B6) G516T influences nevirapine plasma concentrations in HIV-infected patients in Uganda.
17329992 2007 Stereoselective block of hERG channel by (S)-methadone and QT interval prolongation in CYP2B6 slow metabolizers.
17235330 2007 Predictive value of known and novel alleles of CYP2B6 for efavirenz plasma concentrations in HIV-infected individuals.
17223085 2007 CYP2B6 genotype alters abstinence rates in a bupropion smoking cessation trial.
17178267 2006 ABCB1 and cytochrome P450 genotypes and phenotypes: influence on methadone plasma levels and response to treatment.
17054410 2006 Pyrosequencing-based screening for genetic polymorphisms in cytochrome P450 2B6 of potential clinical relevance.
17047492 2006 Multilocus genetic interactions and response to efavirenz-containing regimens: an adult AIDS clinical trials group study.
17015050 2006 Determinants of the rate of nicotine metabolism and effects on smoking behavior.
16951995 2006 Intra- and inter-ethnic differences in the allele frequencies of cytochrome P450 2B6 gene in Chinese.
16912957 2006 Pharmacogenetics of nevirapine-associated hepatotoxicity: an Adult AIDS Clinical Trials Group collaboration.
16815693 2006 Genetic polymorphisms of cytochrome P450 2B6 gene in Han Chinese.
16772608 2006 Cytochrome P450 2C19 loss-of-function polymorphism is a major determinant of clopidogrel responsiveness in healthy subjects.
16623664 2006 Cohesin protein SMC1 represses the nuclear receptor CAR-mediated synergistic activation of a human P450 gene by xenobiotics.
16538176 2006 Genetic susceptibility to carbamazepine-induced cutaneous adverse drug reactions.
16506047 2006 Prevalence of CYP2B6 alleles in malaria-endemic populations of West Africa and Papua New Guinea.
16495778 2006 Identification of a novel specific CYP2B6 allele in Africans causing impaired metabolism of the HIV drug efavirenz.
16433869 2006 Interpatient variability in the pharmacokinetics of the HIV non-nucleoside reverse transcriptase inhibitor efavirenz: the effect of gender, race, and CYP2B6 polymorphism.
16392089 2006 Pharmacogenetics of plasma efavirenz exposure after treatment discontinuation: an Adult AIDS Clinical Trials Group Study.
16338275 2005 Methadone enantiomer plasma levels, CYP2B6, CYP2C19, and CYP2C9 genotypes, and response to treatment.
16267764 2005 Pharmacogenetics of long-term responses to antiretroviral regimens containing Efavirenz and/or Nelfinavir: an Adult Aids Clinical Trials Group Study.
16183265 2006 Pharmacogenetics of cyclophosphamide in patients with hematological malignancies.
16125881 2005 Influence of genetic polymorphisms of styrene-metabolizing enzymes and smoking habits on levels of urinary metabolites after occupational exposure to styrene.
16116487 2005 Association of cyclophosphamide pharmacokinetics to polymorphic cytochrome P450 2C19.
15864119 2005 Influence of CYP2B6 polymorphism on plasma and intracellular concentrations and toxicity of efavirenz and nevirapine in HIV-infected patients.
15825040 2005 Influence of 516G>T polymorphisms at the gene encoding the CYP450-2B6 isoenzyme on efavirenz plasma concentrations in HIV-infected subjects.
15622315 2004 Pharmacogenetics of efavirenz and central nervous system side effects: an Adult AIDS Clinical Trials Group study.
15572372 2005 AMP-activated protein kinase mediates phenobarbital induction of CYP2B gene expression in hepatocytes and a newly derived human hepatoma cell line.
15563456 2005 Novel CAR-mediated mechanism for synergistic activation of two distinct elements within the human cytochrome P450 2B6 gene in HepG2 cells.
15469410 2004 Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population.
15383491 2004 Haplotype structure and allele frequencies of CYP2B6 in a Korean population.
15284537 2004 Pharmacogenetic roles of CYP2C19 and CYP2B6 in the metabolism of R- and S-mephobarbital in humans.
15248218 2004 Cytochrome P450 pharmacogenetics as a predictor of toxicity and clinical response to pulse cyclophosphamide in lupus nephritis.
15194512 2004 Homozygous CYP2B6 *6 (Q172H and K262R) correlates with high plasma efavirenz concentrations in HIV-1 patients treated with standard efavirenz-containing regimens.
15190123 2004 Multiple novel nonsynonymous CYP2B6 gene polymorphisms in Caucasians: demonstration of phenotypic null alleles.
15178651 2004 Identification of CYP2B6 sequence variants by use of multiplex PCR with allele-specific genotyping.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15039299 2004 Quantitative contribution of CYP2D6 and CYP3A to oxycodone metabolism in human liver and intestinal microsomes.
14977870 2004 Regulation of CYP2B6 in primary human hepatocytes by prototypical inducers.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14551287 2003 Hepatic CYP2B6 expression: gender and ethnic differences and relationship to CYP2B6 genotype and CAR (constitutive androstane receptor) expression.
14515060 2003 Bupropion and 4-OH-bupropion pharmacokinetics in relation to genetic polymorphisms in CYP2B6.
12814665 2003 Smoking, alcoholism and genetic polymorphisms alter CYP2B6 levels in human brain.
12738724 2003 Cytochrome p450 and glutathione transferase expression in human breast cancer.
12721789 2003 Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population.
12642465 2003 Functional characterization of cytochrome P450 2B6 allelic variants.
12629583 2003 Role of polymorphic human CYP2B6 in cyclophosphamide bioactivation.
12571232 2003 A novel distal enhancer module regulated by pregnane X receptor/constitutive androstane receptor is essential for the maximal induction of CYP2B6 gene expression.
12490624 2003 Analysis of differential substrate selectivities of CYP2B6 and CYP2E1 by site-directed mutagenesis and molecular modeling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439223 2002 Pharmacogenetic investigation of smoking cessation treatment.
12242601 2002 Allele and genotype frequencies of CYP2B6 and CYP3A5 in the Japanese population.
12207635 2002 The influence of CYP2B6, CYP2C9 and CYP2D6 genotypes on the formation of the potent antioestrogen Z-4-hydroxy-tamoxifen in human liver.
11991950 2002 Expression of CYP3A4, CYP2B6, and CYP2C9 is regulated by the vitamin D receptor pathway in primary human hepatocytes.
11695850 2001 Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes.
11602525 2001 CYP2B6 and CYP2C19 as the major enzymes responsible for the metabolism of selegiline, a drug used in the treatment of Parkinson's disease, as revealed from experiments with recombinant enzymes.
11470993 2001 Extensive genetic polymorphism in the human CYP2B6 gene with impact on expression and function in human liver.
11353758 2001 Involvement of CYP2B6 in n-demethylation of ketamine in human liver microsomes.
11298076 2001 Involvement of human liver cytochrome P4502B6 in the metabolism of propofol.
11243870 2001 A single nucleotide polymorphism of CYP2b6 found in Japanese enhances catalytic activity by autoactivation.
10768437 2000 Gene expression in distinct regions of the heart.
10471061 1999 Human CYP2B6: expression, inducibility and catalytic activities.
10037683 1999 The repressed nuclear receptor CAR responds to phenobarbital in activating the human CYP2B6 gene.
9890157 1998 Molecular genetics of the human cytochrome P450 monooxygenase superfamily.
9179987 1997 Molecular modelling of mammalian CYP2B isoforms and their interaction with substrates, inhibitors and redox partners.
8587134 1995 Organization and evolution of the cytochrome P450 CYP2A-2B-2F subfamily gene cluster on human chromosome 19.
8432525 1993 Fluorescence in situ hybridization mapping of human chromosome 19: cytogenetic band location of 540 cosmids and 70 genes or DNA markers.
7668294 1995 A genetic polymorphism in coumarin 7-hydroxylation: sequence of the human CYP2A genes and identification of variant CYP2A6 alleles.
2899870 1988 A novel human cytochrome P450 gene (P450IIB): chromosomal localization and evidence for alternative splicing.
2813061 1989 Alternative splicing in the human cytochrome P450IIB6 gene generates a high level of aberrant messages.
2573390 1989 cDNA cloning and sequence and cDNA-directed expression of human P450 IIB1: identification of a normal and two variant cDNAs derived from the CYP2B locus on chromosome 19 and differential expression of the IIB mRNAs in human liver.
2308828 1990 Alternative splicing in the human cytochrome P450IIB6 gene: use of a cryptic exon within intron 3 and splice acceptor site within exon 4.