Property Summary

Ligand Count 2
NCBI Gene PubMed Count 295
PubMed Score 5078.97
PubTator Score 1809.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (9)

Disease log2 FC p
chronic rhinosinusitis -1.303 1.5e-02
lung adenocarcinoma -1.200 3.3e-04
lung cancer -1.100 7.0e-03
lung carcinoma -4.100 1.3e-40
nephrosclerosis -1.290 2.8e-04
non primary Sjogren syndrome sicca -1.200 3.2e-02
pancreatic ductal adenocarcinoma liver m... -2.956 3.5e-03
psoriasis -1.100 3.5e-03
ulcerative colitis -1.800 3.4e-04

Protein-protein Interaction (4)

PDB (12)

Gene RIF (300)

AA Sequence

MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHL      1 - 70
GPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKR     71 - 140
SVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLIS    141 - 210
SVFGQLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAH    211 - 280
SEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTE    281 - 350
AVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL    351 - 420
KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTYQIRFLP    421 - 490
R//

Text Mined References (300)

PMID Year Title