Property Summary

NCBI Gene PubMed Count 15
PubMed Score 66.58
PubTator Score 21.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 2.4e-04
Disease Target Count Z-score Confidence
substance-related disorder 104 0.0 2.0
Disease Target Count Z-score Confidence
Intermittent claudication 16 3.351 1.7
Malignant hyperthermia 25 3.21 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 2.4e-04

Gene RIF (4)

PMID Text
25710939 CYP2A7 affects CYP2A6 expression by competing for miR-126* binding.
16636685 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
12325023 Observational study of genotype prevalence. (HuGE Navigator)
11960914 CYP2A6/2A7 and CYP2E1 expression in human oesophageal mucosa: regional and inter-individual variation in expression and relevance to nitrosamine metabolism

AA Sequence

MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMKFSECYGPVFT      1 - 70
IHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSNGERAKQLLRFAIATLRDFGV     71 - 140
GKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLSMMLGIFQ    141 - 210
FTSTSTGQLYEMFSSVMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEK    211 - 280
NPNTEFYLKNLMMSTLNLFIAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMP    281 - 350
YMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDK    351 - 420
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVFATIPRNYTMS    421 - 490
FLPR                                                                      491 - 494
//

Text Mined References (16)

PMID Year Title
25710939 2015 CYP2A7 pseudogene transcript affects CYP2A6 expression in human liver by acting as a decoy for miR-126.
22890016 2012 Differential distribution of CYP2A6 and CYP2A13 in the human respiratory tract.
16636685 CYP2A7 polymorphic alleles confound the genotyping of CYP2A6*4A allele.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12325023 2002 Characterization of a novel CYP2A7/CYP2A6 hybrid allele (CYP2A6*12) that causes reduced CYP2A6 activity.
11960914 2002 CYP2A6/2A7 and CYP2E1 expression in human oesophageal mucosa: regional and inter-individual variation in expression and relevance to nitrosamine metabolism.
10493259 1999 The CYP2A subfamily: function, expression and genetic polymorphism.
10353262 1999 Expression of CYP2A genes in human liver and extrahepatic tissues.
9890157 1998 Molecular genetics of the human cytochrome P450 monooxygenase superfamily.
8587134 1995 Organization and evolution of the cytochrome P450 CYP2A-2B-2F subfamily gene cluster on human chromosome 19.
8043031 1994 Expression of xenobiotic-metabolizing cytochrome P450 forms in human adult and fetal liver.
7864805 1995 Expression and alternative splicing of the cytochrome P-450 CYP2A7.
7668294 1995 A genetic polymorphism in coumarin 7-hydroxylation: sequence of the human CYP2A genes and identification of variant CYP2A6 alleles.
2322567 1990 The CYP2A3 gene product catalyzes coumarin 7-hydroxylation in human liver microsomes.