Property Summary

NCBI Gene PubMed Count 255
PubMed Score 676.80
PubTator Score 666.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 3.1e-12

Protein-protein Interaction (1)

Gene RIF (264)

PMID Text
26818358 carcinogen exposure and thereby lower risk of lung cancer. Despite the association between nicotine metabolism (CYP2A6 activity phenotype and diplotypes) and smoking intensity
26757861 No associations were found between the analyzed variants and smoking, however, there was an association among non-smoking subjects between the A allele of rs16969968 and high body mass index.
26725431 It was concluded that, although decreased CYP2A6 AS tended to reduce the risk of bladder cancer in Japanese smokers, no significant association was recognized in this population.
26662855 lower lung cancer risk observed in CYP2A6 poor metabolizers is partially explained by the strong influence of CYP2A6 genetic polymorphisms on nicotine uptake and metabolism
26644138 Slow nicotine metabolism mediated by CYP2A6 increases risk for tobacco dependence throughout adolescence.
26407342 The detected CYP2A6 variants explain a strikingly large fraction of variance (up to 31%) in nicotine metabolite ratio (NMR) in these study samples.
26366873 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26343999 We have for the first time demonstrated that the tumor suppressor protein, p53, is a regulator of the CYP2A6 gene.
26247835 P450 2A13 is one of the important enzymes that oxidizes polycyclic aromatic hydrocarbons
26098700 phenotypic association studies in population in Nigeria: Data suggest polymorphisms in CYP2A6 exist in the population studied; distribution of CYP2A6 activity is trimodal; influence of age/sex on activity are not significant in this biomarker study.
26091970 CYP2A6 genetic polymorphisms may play important roles in the development of SQCC in Japanese smokers.
25857233 Report isolation of CYP2A6 inhibitors from Vernonia cinerea.
25744963 Reduced metabolism CYP2A6 genotypes are associated with both risk and protective effects in young smokers.
25710939 CYP2A7 affects CYP2A6 expression by competing for miR-126* binding.
25683822 meta-analysis suggests that CYP2A6 gene polymorphism is associated with daily cigarette consumption. No association with tobacco dependence was found.
25526961 Nicotine dependence among current smokers homozygous for the SLC6A3 10r allele was lower than that of smokers carrying minor alleles, a CYP2A6 polymorphism might mediate this association.
25220663 The effects of Smilax root on reactive oxygen species and CYP2A6 expression in Hep G2 cells are reported.
25072098 Genetic variation in CYP2A6 protein influence smoking behaviors to carbon monoxide level.
25006744 CYP2A6 is located within genes previously associated with chronic obstructive pulmonary disease susceptibility in smokers.
24988984 differences in genetic variations and haplotypes of CYP2A6, CYP2B6, CYP2C8, and CYP2E1 were observed among ethnic populations.
24651583 Polymorphisms in CYP2A6 gene is associated with Crohn's disease.
24305170 study identified seven novel nonsynonymous variants in a population of African American light smokers; each reduced in-vitro CYP2A6 protein expression, enzymatic activity and/or stability, consistent with the associated slow metabolism phenotype.
24192532 CYP2A6 and UGT2B10 genotype explain 53% of the variance in oral nicotine glucuronidation. They are also significantly associated with undeuterated (D0) nicotine glucuronidation in individuals smoking ad libitum.
24163286 secondhand smoke-exposed pregnant women with CYP2A6*1/*4 or *4/*4 genotype had a significantly lower median cotinine level than women with CYP2A6*1/*1 genotype
24127329 Genetic variations in CYP2A6 gene or genotypes associated with reduced synaptic serotonin activity may influence the success of smoking cessation treatment.
24045616 Results show that variants in two adjacent genes, EGLN2 and CYP2A6, influence smoking behavior related to disease risk.
24033696 Nicotine replacement therapy is effective among individuals with fast, but not slow, CYP2A6-defined nicotine metabolism. The effect of bupropion on relapse likelihood is unlikely to be affected by nicotine metabolism as estimated from CYP2A6 genotype.
23813797 Selective chemical inhibitors of CYP2A6 inhibited metronidazole 2-hydroxylation.
23733493 The presence of the CYP2A6 *1/*1 deletion polymorphism might be associated with an increased lung cancer risk, especially for Asians.
23649654 Gene deletion of CYP2A6 might decrease the risk of tobacco-related lung cancer in Asians. [Meta-analysis]
23528144 Though related to smoking dose, CYP2A6 may not influence smoking cessation.
23471717 A three-order interaction between CYP2A6, CYP1A1, and CYP2D6 polymorphisms in lung cancer risk is found in patients from central south China.
23462429 Thus, CYP2A6 slow metabolism is associated with increased adolescent smoking cessation, indicating that even early in the smoking history, genetic variation is influencing smoking cessation.
23371292 CYP2A6-Reduced function genetic variants decreased cotinine removal more than cotinine formation.
23292114 show that *1A/*1A homozygotes have a significantly lower ratio, due to both a reduction in spliced forms and an increase in unspliced or partially spliced CYP2A6
23203414 We did not find statistically significant relationships between CYP2A6 genotypes and lung cancer in studies that included both never smokers and smokers [meta-analysis].
23178447 results indicate that the CYP1A1*2B allele (rs4646903 and rs1048943) is associated with an increased lung cancer risk and CYP2A6*4 is associated with a decreased lung cancer risk in the Bangladeshi population
23049750 Haplotypes with copy number and single nucleotide polymorphisms in CYP2A6 locus are associated with smoking quantity in a Japanese population.
22890016 The differential distribution pattern of CYP2A6 in the respiratory tract, which is of importance in considering the pulmonary susceptibility to carcinogens and the following lung cancer development, is detailed.
22854688 In this sample of Chilean individuals we did not find a relation between any CYP2A6 genotype with smoking or tobacco dependence.
22850738 CYP2A6 activity was higher in Swedes compared to Koreans (p<0.0001), even among carriers of rapid genotypes. We report major differences in CYP2A6 enzyme activity between Swedes and Koreans mainly due to CYP2A6 genetic variation but not exclusively.
22847926 PON1 Gln192Arg and CYP2A6*9(-48T>G) polymorphisms were associated with DNA damage induced by pesticides and cell death in Brazilian tobacco farmers.
22706231 there is a clear link between CYP2A6 genotypes, smoking behavior, and lung cancer risk--{REVIEW}
22696418 Report CYP2A-selective inhibitors to accurately distinguish between CYP2A6 and CYP2A13 activity.
22614024 GSTM1 null and CYP2A6*9 showed significant associations with cytokinesis-blocked micronuclei assay results in lymphocytes of tobacco farmers
22547082 The effect of genetic variants on the role of CYP2A6 in drug metabolism, is reviewed.
22498344 CYP2A6 plays a key role in nicotine metabolism and oxidative stress in astrocytes, and this has implications in nicotine-associated brain toxicity
22497566 CYP2A6 most striking feature seems to be strong upregulation by diverse toxic stimuli, controlled by several stress activated gene regulators involving transcriptional & post-transcriptional processes; CYP2A6 may serve as indicator for liver toxicity
22465937 CYP2A6 may function as human "Bilirubin Oxidase" where bilirubin is potentially a substrate and a regulator of the enzyme
22342802 We found significant differences in neural response to smoking cues based on genetic variation in CYP2A6
22322240 The findings indicated that a population of digestive system cancer patients carries a high frequency of the CYP2A6*4C homozygous genotype.
22271297 There were no significant differences in dexmedetomidine clearance among normal, intermediate, and slow CYP2A6 metabolizer groups.
22217675 smoking quantity was positively associated with hypertension and that CYP2A6 genotypes may moderate this relationship.
22160797 Heavy smoking may increase the risk of abdominal obesity-particularly in smokers with CYP2A6 poor metabolizer genotypes.
22073590 CYP2A6 activity is depedent on CYP2A6 gene type, which has been found to have a significant effect on smoking.
21964962 Heavy smoking is significantly associated with type 2 diabetes mellitus, an association that is moderated by the CYP2A6 genotype.
21791872 data indicate that CYP2A6 deletions may be associated with decreased risk of lung cancer in the Japanese population studied.
21765098 CHRNA5 and CYP2A6 genotypes appeared to be independent, with each approximately doubling the odds of being a regular smoker by age 18 years.
21747048 Variation in CYP2A6 was independently associated with increased cigarette consumption, nicotine dependence, and lung cancer risk. CYP2A6 and CHRNA5-A3-B4 appear to be more strongly associated with smoking behaviors and lung cancer risk, respectively.
21745589 The data provide evidence to support the concept that enhanced CYP2A6 activity and diminished CYP2E1 activity probably involve to the progression of cholangiocarcinoma.
21685187 Associations of CHRNA3/CHRNA5 and CYP2A6 loci with CPD and DBH with smoking cessation are also likely of importance in the smoking behaviours of patients with COPD.
21521021 CYP2A6*4 and the novel CYP2A6*1B variant were the major genetic determinants of interindividual variability in 5-FU formation from tegafur in Chinese livers.
21473878 relative effects of CYP2A6 and CYP2A13 on metabolic activation of 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK) and its mutagenesis in lung cells; CYP2A6 and CYP2A13 enhanced alpha-hydroxylation of NNK; alpha-hydroxylation activity of CYP2A13 was higher
21418183 Chalepensin was a substrate and a mechanism-based inhibitor of human CYP2A6; oral administration of chalepensin to mice reduced hepatic coumarin 7-hydroxylation activity ex vivo
21410749 results of analysis of CYP2A6 allele freq in So. Americans & confirms ethnic diffs in CYP2A6 gene SNPs btw Spaniards and Mestizo Ecuadorians involved in allele-disease assocn studies espec in CYP2A6 polymorphism studies & tobacco-related cancer
21326246 CYP2A6 genotypes are associated with differences in the biotransformation of S-1. However, the impact of the CYP2A6 polymorphism on variations in clinical efficacy or toxicity requires further evaluation.
21265876 The frequencies of CYP2A6*2, CYP2A6*4A and CYP2A6*5 alleles in South Indian population were 1, 8.9 and 0.7%, respectively; frequencies in this population are distinct from Caucasians, Chinese, Japanese, African Americans and other compared populations.
21205058 Reduced metabolism function of cytochrome P450 2A6 in smokers appears to be associated with fewer cigarettes smoked, later initiation of smoking regularly, shorter smoking duration and lower likelihood of smoking cessation.
20887713 Human CYP2A6 is regulated via Nrf2, suggesting that CYP2A6 is induced under oxidative stress.
20860463 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20734048 Observational study of gene-disease association. (HuGE Navigator)
20719908 Carbamazepine likely induces hepatic metabolism via CYP2A6 and is associated with increased 3HC/cotinine ratios.
20717551 Observational study of gene-disease association. (HuGE Navigator)
20701904 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20656072 Data show that CYP2A6 and CYP1A2 have the least malleable active sites while those of CYP2D6, CYP2C9 and CYP3A4 have considerably greater degrees of flexibility or malleability.
20647221 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20596643 CYP2A6 genotype did not affect the AUC of 5-FU, although the clearance of tegafur was lower in patients with 2 variant alleles of CYP2A6 than in patients with the wild-type or 1 variant allele.
20596643 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20506136 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20438369 Association between nicotine metabolism and CYP2A6*1 and CYP2A6*4 genotypes in an Iranian population is reported.
20438369 Observational study of gene-disease association. (HuGE Navigator)
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20418888 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20418888 CHRNB3-CHRNA6 and CYP2A6 sequence variants affect smoking behavior
20336063 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20177288 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20155256 Observational study of gene-disease association. (HuGE Navigator)
20139165 Data suggest that individuals carrying the CYP2A6*22 allele are likely to have lower metabolism of CYP2A6 substrate than individuals expressing CYP2A6*15, CYP2A6*16, CYP2A6*21, and the wild type.
20136358 As new variants are discovered, the relationships between CYP2A6 genotype, nicotine metabolism, smoking behaviors and tobacco-related cancer risk will be further clarified
20089352 The presently evaluated variant alleles in the CYP2A6, CYP2B6, and CYP2C9 genes may explain part of the substantial variability in valproate pharmacokinetics between different subjects
20089352 Observational study of gene-disease association. (HuGE Navigator)
20061389 conformational change of P450 2A6 follows substrate binding, equilibrium of P450-substrate complex with a non-productive form, and oxidation of aldehydes to carboxylic acids,a process avoiding relaxation of the conformation following the first oxidation
20012030 Identified genotype, gender, and exposure to inducers as sources of variation in CYP2A6 expression and activity.
20012030 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19921195 Observational study of genetic testing. (HuGE Navigator)
19845430 The results characterized the roles of P450 forms in human liver microsomes, particularly that of polymorphic CYP2A6, in letrozole metabolism.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19779319 findings demonstrate independent effects of CYP2A6 and UGT2B7 genetic variation on efavirenz disposition beyond that of the CYP2B6 polymorphisms.
19779319 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19703308 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
19702528 Structure, function, regulation and polymorphism. (Review)
19659438 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19643819 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19604090 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19537956 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19533856 Case-control study indicates low weight placentas are associated with increased risk of low birth weight. Gene variation CYP2A6 is associated with a light placenta and a higher prevalence of LBW compared to mothers with normal genes.
19533856 Observational study of gene-disease association. (HuGE Navigator)
19479063 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19454817 High levels of CYP2A6 activity, as measured by a caffeine phenotyping assay, were positively associated with pancreatic cancer in this casecontrol study among a Midwestern U.S. population
19415821 A substantial influence of CYP2A6 polymorphism as well as the interaction with MAOA resulting in risk modulation on smoking behavior in Chinese male population.
19415821 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19406142 a combination of variant genotype of CYP2A6 and wild-type genotype of GSTP1 exhibited a very poor treatment response in head and neck cancer patients.
19406142 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19387893 CYP2A6 was the specific isozyme responsible for the hydroxyl metabolism of tanshinone IIa (5 microM) in human liver microsomes.
19371316 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19365400 we identified three novel CYP2A6 alleles (CYP2A6(*)35, (*)36 and (*)37); the higher allele frequency variant CYP2A6(*)35 was associated with lower CYP2A6 activity.
19365400 Observational study of gene-disease association. (HuGE Navigator)
19361454 Observational study of genotype prevalence. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19303722 It is suggested that NAT2 slow-acetylator, GSTM1 null, GSTM1/GSTT1-double null, and variant CYP2A6 genotypes may play important roles in the development of bladder cancer in Henan area, China
19303722 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19300303 Additive genetic factors are prominent in determining variation in plasma ratio 3'hydroxycotinine to cotinine (3HC/COT) but less so in determining variation in urine 3HC/COT.
19300303 Observational study of gene-disease association. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19279561 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19251454 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19225447 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19104915 Development of a new predictive model for interactions with human cytochrome P450 2A6 using pharmacophore ensemble/support vector machine (PhE/SVM) approach.
19082995 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19040121 Detected by polymerase chain reaction in prostate tissue.
19012698 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18979093 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18976031 CYP2A6 allele distribution in the Iranian population was different from previous reports for other ethnic groups. It is important to conduct further studies to investigate the implications on smoking dependence and cancer in Iranians.
18976031 Observational study of genotype prevalence. (HuGE Navigator)
18941913 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18715882 study found that CYP2A6 activity measured by caffeine phenotyping was significantly influenced by age, oral contraceptive use, and possibly by gender
18698229 Genetic polymorphisms of CYP2A6 affect the in-vivo pharmacokinetics of pilocarpine
18698229 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18666753 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18425152 Observational study of genotype prevalence. (HuGE Navigator)
18380793 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18360915 functionally characterized four nonsynonymous CYP2A6 sequence variants with respect to their haplotype, allele frequency, and association with in vivo CYP2A6 activity
18360915 Observational study of gene-disease association. (HuGE Navigator)
18216723 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18212800 The AUC(0-10) for tegafur was 1.5-fold higher in patients with the CYP2A6*4C allele than in those without. Also, patients with the CYP2A6*4C allele had a significantly lower maximum plasma concentration for 5-FU than patients without the CYP2A6*4C allele
18212800 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18188752 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18004205 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18004205 CYP2B6 genetic variation is associated with the metabolism of nicotine and cotinine among individuals with decreased CYP2A6 activity
17979512 CYP2A6 genetic variation and its impact on in vivo nicotine kinetics, including a description of variants and phenotyping approaches for assessing in vivo CYP2A6 activity.[REVIEW]
17934923 Observational study of gene-disease association. (HuGE Navigator)
17934923 CYP2A6*4C gene and the Openness personality trait may affect the development of the smoking behavior of youth.
17927692 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17916905 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17683511 Overexpression of CYP2A6 is associated with colorectal tumors
17646279 CYP2A6 is directly induced by estradiol in an ERalpha-dependent manner, implying a biological role of CYP2A6 in estrogen-responsive tissues.
17549345 CYP2A6 overexpression in human lung cancers correlates with a high malignant status
17540336 Human P450 2A6 displays a small active site that is well adapted for the oxidation of small planar substrates.
17522595 Observational study of gene-disease association. (HuGE Navigator)
17522595 CYP2A6*1B genotype is associated with faster nicotine clearance in vivo.
17454707 Observational study of gene-disease association. (HuGE Navigator)
17454707 study investigated the association of CYP2A6 genotype with smoking topography
17267622 Observational study of genotype prevalence. (HuGE Navigator)
17267622 identification of a novel CYP2A6 gene duplication created through an unequal crossover with the CYP2A7 gene; findings suggest the duplicated allele, which is specific for African Americans, would increase nicotine metabolism & may affect smoking behavior
17259654 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17220563 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17220563 Results demonstrate that in vivo phenotyping of CYP2A6 using nicotine and coumarin are not metabolically equivalent.
17207267 De novo formation of indican in transgenic tobacco plants hampered indigo formation, it supports the contention that biosynthetic pathways can be efficiently mimicked by metabolic engineering of this protein.
17156750 comparison of substrate dynamics in CYP2E1 and CYP2A6
17130279 Observational study of gene-disease association. (HuGE Navigator)
17112802 Observational study of gene-disease association. (HuGE Navigator)
17112802 Results will enhance the interpretation of CYP2A6 genotypic data as used in association studies of smoking behavior and its health consequences.
17036930 Observational study of genotype prevalence. (HuGE Navigator)
17015050 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16952495 Observational study of gene-disease association. (HuGE Navigator)
16891249 Observational study of genotype prevalence. (HuGE Navigator)
16891249 A statistically significant high frequency of the duplicated CYP2A6*1x2 allele occurred among Chinese. Among Malays and Chinese, the most common allele was CYP2A6*1B, but it was CYP2A6*1A among Indians.
16857725 CYP2A6 is induced via PXR and PGC-1alpha through the DR4-like element at the distal response region.
16758265 no substantial differences in nicotine metabolism between those without the variant (CYP2A6*1/*1, n = 163) and those with the variant (CYP2A6*1/*21, n = 9)
16720336 Observational study of gene-disease association. (HuGE Navigator)
16636685 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
16470306 Observational study of genotype prevalence. (HuGE Navigator)
16452582 Observational study of gene-disease association. (HuGE Navigator)
16402128 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16402128 Findings indicate that CYP2A6 genotype influences smoking behaviour in a Caucasian treatment-seeking population and that CYP2A6 genotype affects plasma levels obtained from, and usage of, nicotine replacement therapy.
16402086 Observational study of gene-disease association. (HuGE Navigator)
16402086 CYP2A6 genotypes are related with nicotine dependence, influencing smoking habits and withdrawal symptoms in quitting smoking.
16378601 The 3'-UTR of CYP2A6 has a pronounced effect on gene expression and stability of corresponding mRNA and enzyme expression
16377082 Observational study of gene-disease association. (HuGE Navigator)
16372023 The CYP2A6*9 allele was significantly more frequent in Maori smokers (70%) compared to Europeans (30%). The Maori smokers also demonstrated a reduced metabolic rate and reduced nicotine intake.
16272956 Observational study of gene-disease association. (HuGE Navigator)
16207711 analysis of coumarin 7-hydroxylation activity of cytochrome P450 2A6
16176798 Observational study of gene-disease association. (HuGE Navigator)
16176798 Subjects carrying the CYP2A6*4C allele have lower risk of tobacco-related lung cancer; epidemiological studies indicate that smokers homozygous for the CYP2A6*4C allele show much lower odds ratios toward cancer risk.
16126166 In the first CYP2A6 transgenic mouse model, systemic clearance of coumarin is significantly higher in CYP2A6 transgenic mice than in C57BL controls, consistent with the predicted role of CYP2A6 as the major coumarin hydroxylase in human liver.
16086027 CYP2A6 structure shows a compact, hydrophobic active site with one hydrogen bond donor, Asn297, that orients coumarin for regioselective oxidation
16048566 Observational study of gene-disease association. (HuGE Navigator)
16041240 Observational study of gene-disease association. (HuGE Navigator)
16041240 analysis of CYP2A6 phenotype variants in Caucasians
16006997 Observational study of gene-disease association. (HuGE Navigator)
15993850 Observational study of genotype prevalence. (HuGE Navigator)
15940289 Observational study of gene-disease association. (HuGE Navigator)
15940289 CYP2A6*1B is associated with the number of cigarettes smoked per day.
15900015 Observational study of gene-disease association. (HuGE Navigator)
15861044 Observational study of genotype prevalence. (HuGE Navigator)
15861044 analysis of CYP2A6*7, CYP2A6*8 and CYP2A6*10 assessed with a novel haplotyping method in different ethnic populations
15861035 Observational study of gene-disease association. (HuGE Navigator)
15861035 CYP2A6 has some genetic influence on nicotine metabolism
15671201 Constitutive hepatic expression of CYP2A6 is governed by an interplay between the transcription factors HNF-4alpha, C/EBPalpha, C/EBPbeta, and Oct-1.
15665333 Kinetic analysis of oxidation of coumarins by human cytochrome P450 2A6
15660270 Observational study of genotype prevalence. (HuGE Navigator)
15592323 Observational study of genotype prevalence. (HuGE Navigator)
15564629 Observational study of gene-disease association. (HuGE Navigator)
15534625 Observational study of gene-disease association. (HuGE Navigator)
15475735 Observational study of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
15475735 CYP2A6 has a role in rate of nicotine metabolism in adult Caucasians
15454735 Identification of deletion-junction site of CYP2A6*4B allele lacking entire coding region of CYP2A6 in Japanese.
15370155 Meta-analysis of gene-disease association. (HuGE Navigator)
15327835 Observational study of gene-disease association. (HuGE Navigator)
15308589 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15308589 CYP2A6 genetic polymorphisms is associated with smoking behavior and tobacco-related lung cancer risk
15225612 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
15225612 A method that can distinguish between CYP2A6*4A, CYP2A6*4D, and CYP2A6*1F which could otherwise cause a mistyping as CYP2A6*4D.
15203795 Meta-analysis of gene-disease association. (HuGE Navigator)
14981342 In this study it was suggested that the CYP2A6AST;4C allele may prevent the carrier from smoking and the CYP2A6AST;1A/AST;1B heterozygote may be at risk for developing smoking behavior.
14583682 Polymorphism in the promoter region of the CYPA6 reduced the expression levels of CYP2A6 mRNA and protein in liver, resulting in the decrease of coumarin-7-hydroxylase activities.
14568264 For the first time CYP2A6 is reported as a hepatic autoantigen in patients with viral hepatitis caused by flaviviruses and in particular in HCV/anti-LKM-1 positive patients.
12883749 Observational study of gene-disease association. (HuGE Navigator)
12844137 Observational study of gene-disease association. (HuGE Navigator)
12844137 The mutation in the TATA box (CYP2A6*9 allele) caused the decreased in vivo enzymatic activity; the CYP2A6*9 allele caused the decreased expression level and enzymatic activity of CYP2A6 in human liver.
12749606 Observational study of gene-disease association. (HuGE Navigator)
12749606 Despite the possible protection against active smoking behavior in subjects homozygous for the deletion allele, the CYP2A6 polymorphism has only a limited impact on public health because no protective effect was found in heterozygous subjects.
12708602 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12445030 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12419832 Observational study of gene-disease association. (HuGE Navigator)
12406643 genetic variation of CYP2A6 and its resulting effects on metabolism and health consequences [review]
12325023 Observational study of genotype prevalence. (HuGE Navigator)
12223434 Observational study of gene-disease association. (HuGE Navigator)
12172220 D-type is a genotype heterozygous for the CYP2A6*4A and another novel entire CYP2A6 gene-deleted allele, CYP2A6*4B
12164325 Observational study of genotype prevalence. (HuGE Navigator)
12162851 The metabolism of coumarin via 7-hydroxylation in the human (CYP2A6) and mouse (CYP2A5) enzymes is explained in terms of molecular modelling of the active site interactions.
12115524 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12115524 CTY2A6 deletion is associated with gastric adenocarcinoma among Japanese populations.
11960914 CYP2A6/2A7 and CYP2E1 expression in human oesophageal mucosa: regional and inter-individual variation in expression and relevance to nitrosamine metabolism
11960911 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11960911 CYP2A6 gene deletion reduces oral cancer risk in betel quid chewers in Sri Lanka
11927840 Observational study of gene-disease association. (HuGE Navigator)
11927498 CYP2A6 activity, measured by urinary caffeine metabolite ratio, strongly related to colorectal cancer risk
11805739 Genetic variation in CYP2A6-mediated nicotine metabolism alters smoking behavior.
11725533 Observational study of gene-disease association. (HuGE Navigator)
11684323 Observational study of genotype prevalence. (HuGE Navigator)
11434509 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11259349 Observational study of gene-environment interaction. (HuGE Navigator)
11241319 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11237731 Observational study of genotype prevalence. (HuGE Navigator)
11207029 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11054771 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFT      1 - 70
IHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSNGERAKQLRRFSIATLRDFGV     71 - 140
GKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSNVISSIVFGDRFDYKDKEFLSLLRMMLGIFQ    141 - 210
FTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEK    211 - 280
NPNTEFYLKNLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMP    281 - 350
YMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLNEK    351 - 420
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMS    421 - 490
FLPR                                                                      491 - 494
//

Text Mined References (261)

PMID Year Title
26818358 2016 Genetic determinants of CYP2A6 activity across racial/ethnic groups with different risks of lung cancer and effect on their smoking intensity.
26757861 2015 [Association between genotype and allele frequencies of CYP2A6*12 and rs16969968 in CHRNA5 variants with smoking and body mass index in young subjects from Northeast Mexico].
26725431 2016 Genetic Polymorphisms of CYP2A6 in a Case-Control Study on Bladder Cancer in Japanese Smokers.
26662855 2016 Genetic determinants of cytochrome P450 2A6 activity and biomarkers of tobacco smoke exposure in relation to risk of lung cancer development in the Shanghai cohort study.
26644138 2016 Variation in CYP2A6 and tobacco dependence throughout adolescence and in young adult smokers.
26407342 2015 A Genome-Wide Association Study of a Biomarker of Nicotine Metabolism.
26366873 2015 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26343999 2015 Tumour suppressor protein p53 regulates the stress activated bilirubin oxidase cytochrome P450 2A6.
26247835 2016 Oxidation of pyrene, 1-hydroxypyrene, 1-nitropyrene and 1-acetylpyrene by human cytochrome P450 2A13.
26098700 2015 Polymorphisms of CYP1A2 and CYP2A6 activity: phenotypes and the effect of age and sex in a Nigerian population.
26091970 2015 CYP2A6 genetic polymorphism is associated with decreased susceptibility to squamous cell lung cancer in Japanese smokers.
25857233 2015 Inhibition effects of Vernonia cinerea active compounds against cytochrome P450 2A6 and human monoamine oxidases, possible targets for reduction of tobacco dependence.
25744963 2016 CYP2A6 Longitudinal Effects in Young Smokers.
25710939 2015 CYP2A7 pseudogene transcript affects CYP2A6 expression in human liver by acting as a decoy for miR-126.
25683822 2015 Association of CYP2A6 gene polymorphisms with cigarette consumption: a meta-analysis.
25526961 2014 Genetic influence of dopamine receptor, dopamine transporter, and nicotine metabolism on smoking cessation and nicotine dependence in a Japanese population.
25220663 2014 Smilax China root extract detoxifies nicotine by reducing reactive oxygen species and inducing CYP2A6.
25072098 2014 Beyond cigarettes per day. A genome-wide association study of the biomarker carbon monoxide.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
24988984 2015 Direct sequencing and comprehensive screening of genetic polymorphisms on CYP2 family genes (CYP2A6, CYP2B6, CYP2C8, and CYP2E1) in five ethnic populations.
24651583 2014 Genetic polymorphisms in metabolizing enzymes modifying the association between smoking and inflammatory bowel diseases.
24305170 2014 Novel CYP2A6 variants identified in African Americans are associated with slow nicotine metabolism in vitro and in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24192532 2013 The contribution of common UGT2B10 and CYP2A6 alleles to variation in nicotine glucuronidation among European Americans.
24163286 2014 Influence of CYP2A6*4 genotypes on maternal serum cotinine among Chinese nonsmoking pregnant women.
24127329 2014 Are serotonergic system genes associated to smoking cessation therapy success in addition to CYP2A6?
24045616 2014 Variants in two adjacent genes, EGLN2 and CYP2A6, influence smoking behavior related to disease risk via different mechanisms.
24033696 2014 Pharmacotherapy effects on smoking cessation vary with nicotine metabolism gene (CYP2A6).
23813797 2013 The role of human cytochrome P450 enzymes in the formation of 2-hydroxymetronidazole: CYP2A6 is the high affinity (low Km) catalyst.
23733493 2013 Cytochrome P450 2A6 deletion polymorphism and risk of lung cancer: a meta-analysis.
23649654 2013 CYP2A6 deletion polymorphism is associated with decreased susceptibility of lung cancer in Asian smokers: a meta-analysis.
23528144 2013 CYP2A6 genotype and smoking behavior in current smokers screened for lung cancer.
23471717 2013 CYP2A6, CYP1A1, and CYP2D6 polymorphisms in lung cancer patients from central south China.
23462429 2013 CYP2A6 slow nicotine metabolism is associated with increased quitting by adolescent smokers.
23371292 2013 The ability of plasma cotinine to predict nicotine and carcinogen exposure is altered by differences in CYP2A6: the influence of genetics, race, and sex.
23292114 2013 A compensatory effect upon splicing results in normal function of the CYP2A6*14 allele.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
23203414 2013 Association between CYP2A6 genetic polymorphisms and lung cancer: a meta-analysis of case-control studies.
23178447 2013 Lung cancer risk in relation to nicotinic acetylcholine receptor, CYP2A6 and CYP1A1 genotypes in the Bangladeshi population.
23049750 2012 Haplotypes with copy number and single nucleotide polymorphisms in CYP2A6 locus are associated with smoking quantity in a Japanese population.
22890016 2012 Differential distribution of CYP2A6 and CYP2A13 in the human respiratory tract.
22854688 2012 [Relation of genetic variants of CYP2A6 with tobacco dependence and smoking habit in Chilean subjects. A pilot study].
22850738 2013 Comparisons of CYP2A6 genotype and enzyme activity between Swedes and Koreans.
22847926 2012 Application of the buccal micronucleus cytome assay and analysis of PON1Gln192Arg and CYP2A6*9(-48T>G) polymorphisms in tobacco farmers.
22706231 2012 CYP2A6: genetics, structure, regulation, and function.
22696418 2012 Evaluation of inhibition selectivity for human cytochrome P450 2A enzymes.
22614024 2012 Genotoxic biomonitoring of tobacco farmers: Biomarkers of exposure, of early biological effects and of susceptibility.
22547082 2012 PharmGKB summary: very important pharmacogene information for cytochrome P-450, family 2, subfamily A, polypeptide 6.
22498344 2012 An LC-MS/MS method for concurrent determination of nicotine metabolites and the role of CYP2A6 in nicotine metabolite-mediated oxidative stress in SVGA astrocytes.
22497566 2013 Function and regulation of the Cyp2a5/CYP2A6 genes in response to toxic insults in the liver.
22465937 2012 Metabolism of bilirubin by human cytochrome P450 2A6.
22342802 2012 Genetic variation in CYP2A6 predicts neural reactivity to smoking cues as measured using fMRI.
22322240 2012 Characteristic CYP2A6 genetic polymorphisms detected by TA cloning-based sequencing in Chinese digestive system cancer patients with S-1 based chemotherapy.
22271297 2012 CYP2A6 genetic variation and dexmedetomidine disposition.
22217675 2013 Association between daily cigarette consumption and hypertension moderated by CYP2A6 genotypes in Chinese male current smokers.
22160797 2012 Relationship between amounts of daily cigarette consumption and abdominal obesity moderated by CYP2A6 genotypes in Chinese male current smokers.
22080838 2012 A genome-wide association study of COPD identifies a susceptibility locus on chromosome 19q13.
22073590 2011 [Genetic analysis for nicotine dependence].
21964962 2011 Interaction between heavy smoking and CYP2A6 genotypes on type 2 diabetes and its possible pathways.
21791872 2011 Association between cancer risk and drug-metabolizing enzyme gene (CYP2A6, CYP2A13, CYP4B1, SULT1A1, GSTM1, and GSTT1) polymorphisms in cases of lung cancer in Japan.
21765098 2011 Combined analysis of CHRNA5, CHRNA3 and CYP2A6 in relation to adolescent smoking behaviour.
21747048 2011 Relationship between CYP2A6 and CHRNA5-CHRNA3-CHRNB4 variation and smoking behaviors and lung cancer risk.
21745589 2012 Hepatic cytochrome P450 2A6 and 2E1 status in peri-tumor tissues of patients with Opisthorchis viverrini-associated cholangiocarcinoma.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21521021 2011 Association analysis of CYP2A6 genotypes and haplotypes with 5-fluorouracil formation from tegafur in human liver microsomes.
21473878 2011 Metabolic effects of CYP2A6 and CYP2A13 on 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK)-induced gene mutation--a mammalian cell-based mutagenesis approach.
21418183 2011 Mechanism-based inhibition of cytochrome P450 (CYP)2A6 by chalepensin in recombinant systems, in human liver microsomes and in mice in vivo.
21410749 2011 Differences between Spaniards and Ecuadorians in CYP2A6 allele frequencies: comparison with other populations.
21326246 2011 Phase II study of S-1 combined with oxaliplatin as therapy for patients with metastatic biliary tract cancer: influence of the CYP2A6 polymorphism on pharmacokinetics and clinical activity.
21265876 2012 Genetic polymorphisms of drug-metabolizing phase I enzymes CYP2E1, CYP2A6 and CYP3A5 in South Indian population.
21205058 2011 Associations of CYP2A6 genotype with smoking behaviors in southern China.
20887713 2011 Human CYP2A6 is regulated by nuclear factor-erythroid 2 related factor 2.
20860463 2010 Influence of host genetic factors on efavirenz plasma and intracellular pharmacokinetics in HIV-1-infected patients.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20734048 2011 Phase II study of biweekly S-1 and oxaliplatin combination chemotherapy in metastatic colorectal cancer and pharmacogenetic analysis.
20719908 2010 Carbamazepine but not valproate induces CYP2A6 activity in smokers with mental illness.
20717551 2010 Biomonitoring of urinary cotinine concentrations associated with plasma levels of nicotine metabolites after daily cigarette smoking in a male Japanese population.
20701904 2010 Early life environment, neurodevelopment and the interrelation with atopy.
20656072 2011 Flexibility of human cytochrome P450 enzymes: molecular dynamics and spectroscopy reveal important function-related variations.
20647221 2011 Associations of various gene polymorphisms with toxicity in colorectal cancer patients receiving oral uracil and tegafur plus leucovorin: a prospective study.
20596643 2010 Pharmacokinetics of S-1 and CYP2A6 genotype in Japanese patients with advanced cancer.
20506136 2010 Genomic copy number variations in three Southeast Asian populations.
20438369 2010 Association between nicotine metabolism and CYP2A6*1 and CYP2A6*4 genotypes in an Iranian population.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20418890 2010 Genome-wide meta-analyses identify multiple loci associated with smoking behavior.
20418888 2010 Sequence variants at CHRNB3-CHRNA6 and CYP2A6 affect smoking behavior.
20336063 2010 Genetic variation in nicotine metabolism predicts the efficacy of extended-duration transdermal nicotine therapy.
20177288 2010 Pharmacogenomics of maternal tobacco use: metabolic gene polymorphisms and risk of adverse pregnancy outcomes.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20155256 2010 In vivo evaluation of CYP2A6 and xanthine oxidase enzyme activities in the Serbian population.
20139165 2010 Functional characterization of cytochrome P450 2A6 allelic variants CYP2A6*15, CYP2A6*16, CYP2A6*21, and CYP2A6*22.
20136358 2010 New CYP2A6 gene deletion and conversion variants in a population of Black African descent.
20089352 2010 The influence of cytochrome oxidase CYP2A6, CYP2B6, and CYP2C9 polymorphisms on the plasma concentrations of valproic acid in epileptic patients.
20061389 2010 Oxidation of N-Nitrosoalkylamines by human cytochrome P450 2A6: sequential oxidation to aldehydes and carboxylic acids and analysis of reaction steps.
20012030 2010 Hepatic CYP2A6 levels and nicotine metabolism: impact of genetic, physiological, environmental, and epigenetic factors.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19921195 2010 Can the 2-(13)C-uracil breath test be used to predict the effect of the antitumor drug S-1?
19845430 2009 Deactivation of anti-cancer drug letrozole to a carbinol metabolite by polymorphic cytochrome P450 2A6 in human liver microsomes.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19779319 2009 CYP2B6, CYP2A6 and UGT2B7 genetic polymorphisms are predictors of efavirenz mid-dose concentration in HIV-infected patients.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19703308 2009 Rapid detection of the CYP2A6*12 hybrid allele by Pyrosequencing technology.
19702528 2009 Structure, function, regulation and polymorphism of human cytochrome P450 2A6.
19659438 2009 CYP2B6 variants and plasma efavirenz concentrations during antiretroviral therapy in Port-au-Prince, Haiti.
19651758 2009 Hepatic cytochrome P450 enzyme alterations in humans with progressive stages of nonalcoholic fatty liver disease.
19643819 2009 Interaction between cytochrome P450 1A2 genetic polymorphism and cigarette smoking on the risk of hepatocellular carcinoma in a Japanese population.
19604090 2009 Association of CYP2A6 polymorphisms with S-1 plus docetaxel therapy outcomes in metastatic gastric cancer.
19537956 2009 CYP1A1 genotype modifies the impact of smoking on effectiveness of HAART among women.
19533856 2008 Influence of antenatal care, placental weight and genetic variation on low birth weight, Makassar Indonesia.
19479063 2009 Phase I metabolic genes and risk of lung cancer: multiple polymorphisms and mRNA expression.
19454817 2009 Phenotypic CYP2A6 variation and the risk of pancreatic cancer.
19415821 2009 Gene-gene interactions of CYP2A6 and MAOA polymorphisms on smoking behavior in Chinese male population.
19406142 2009 Polymorphism in cytochrome P450 2A6 and glutathione S-transferase P1 modifies head and neck cancer risk and treatment outcome.
19387893 2009 Hydroxylation of tanshinone IIa in human liver microsomes is specifically catalysed by cytochrome P4502A6.
19371316 2009 CYP2B6 (c.516G-->T) and CYP2A6 (*9B and/or *17) polymorphisms are independent predictors of efavirenz plasma concentrations in HIV-infected patients.
19365400 2009 A novel CYP2A6 allele (CYP2A6*35) resulting in an amino-acid substitution (Asn438Tyr) is associated with lower CYP2A6 activity in vivo.
19361454 2009 High prevalence of CYP2A6*4 and CYP2A6*9 alleles detected among a Malaysian population.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19303722 2009 Association of NAT2, GSTM1, GSTT1, CYP2A6, and CYP2A13 gene polymorphisms with susceptibility and clinicopathologic characteristics of bladder cancer in Central China.
19300303 2009 Genetic and environmental influences on the ratio of 3'hydroxycotinine to cotinine in plasma and urine.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
19279561 2009 Association of nicotine metabolite ratio and CYP2A6 genotype with smoking cessation treatment in African-American light smokers.
19225447 2009 Pharmacogenetics-based population pharmacokinetic analysis of efavirenz in HIV-1-infected individuals.
19104915 2009 Development of a new predictive model for interactions with human cytochrome P450 2A6 using pharmacophore ensemble/support vector machine (PhE/SVM) approach.
19082995 2009 CYP2A6 genotypes and coumarin-oxidation phenotypes in a Thai population and their relationship to tobacco smoking.
19040121 Detection of cytochrome P450-2A6, -3A5 and -4B1 with real-time polymerase chain reaction in prostate tissue.
19029318 2009 Comprehensive in vitro analysis of voriconazole inhibition of eight cytochrome P450 (CYP) enzymes: major effect on CYPs 2B6, 2C9, 2C19, and 3A.
19012698 2008 Cigarette smoking and glutathione S-transferase M1 polymorphism associated with risk for uterine cervical cancer.
18979093 2009 Pharmacogenomics of CYP2A6, CYP2B6, CYP2C19, CYP2D6, CYP3A4, CYP3A5 and MDR1 in Vietnam.
18976031 2008 CYP2A6 allele frequencies in an Iranian population.
18941913 2009 Coffee intake, variants in genes involved in caffeine metabolism, and the risk of epithelial ovarian cancer.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18779312 2008 Key residues controlling phenacetin metabolism by human cytochrome P450 2A enzymes.
18715882 2008 CYP2A6 activity in a healthy Spanish population: effect of age, sex, smoking, and oral contraceptives.
18698229 2008 Genetic polymorphisms of CYP2A6 affect the in-vivo pharmacokinetics of pilocarpine.
18666753 2006 Genetic and environmental influences on therapeutic and toxicity outcomes: studies with CYP2A6.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18425152 2008 Allele frequency differences of cytochrome P450 polymorphisms in a sample of New Zealand M?ori.
18380793 2008 CYP2A6 and the plasma level of 5-chloro-2, 4-dihydroxypyridine are determinants of the pharmacokinetic variability of tegafur and 5-fluorouracil, respectively, in Japanese patients with cancer given S-1.
18360915 2008 Novel and established CYP2A6 alleles impair in vivo nicotine metabolism in a population of Black African descent.
18356043 2008 Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone.
18216723 2008 A novel CYP2A6 allele, CYP2A6*23, impairs enzyme function in vitro and in vivo and decreases smoking in a population of Black-African descent.
18212800 2008 The CYP2A6*4 allele is determinant of S-1 pharmacokinetics in Japanese patients with non-small-cell lung cancer.
18188752 2008 Interactions between genotype and retrospective ADHD symptoms predict lifetime smoking risk in a sample of young adults.
18004205 2007 Gene-gene interactions between CYP2B6 and CYP2A6 in nicotine metabolism.
17979512 2007 Genetic variability in CYP2A6 and the pharmacokinetics of nicotine.
17934923 2007 CYP2A6 gene polymorphism and personality traits for NEO-FFI on the smoking behavior of youths.
17927692 2008 Growth hormone does not alter CYP2A6 activity in growth hormone-deficient children.
17916905 2007 Polymorphisms of GSTP1 and GSTT1, but not of CYP2A6, CYP2E1 or GSTM1, modify the risk for esophageal cancer in a western population.
17683511 2007 Overexpression of CYP2A6 in human colorectal tumors.
17646279 2007 Human CYP2A6 is induced by estrogen via estrogen receptor.
17549345 2007 CYP2A6 overexpression in human lung cancers correlates with a high malignant status.
17540336 2007 Structural insight into the altered substrate specificity of human cytochrome P450 2A6 mutants.
17522595 2008 Identification of novel CYP2A6*1B variants: the CYP2A6*1B allele is associated with faster in vivo nicotine metabolism.
17454707 2007 An association of CYP2A6 genotype and smoking topography.
17267622 2007 A novel duplication type of CYP2A6 gene in African-American population.
17259654 2007 Development of lung cancer before the age of 50: the role of xenobiotic metabolizing genes.
17220563 2006 In vivo evaluation of coumarin and nicotine as probe drugs to predict the metabolic capacity of CYP2A6 due to genetic polymorphism in Thais.
17207267 2007 Formation of the indigo precursor indican in genetically engineered tobacco plants and cell cultures.
17156750 2007 A comparison of substrate dynamics in human CYP2E1 and CYP2A6.
17130279 2007 The role of CYP2A6 in the emergence of nicotine dependence in adolescents.
17125252 2006 Synthetic inhibitors of cytochrome P-450 2A6: inhibitory activity, difference spectra, mechanism of inhibition, and protein cocrystallization.
17112802 2006 CYP2A6 genotype and the metabolism and disposition kinetics of nicotine.
17036930 2006 CYP2A6 polymorphism reveals differences in Japan and the existence of a specific variant in Ovambo and Turk populations.
17015050 2006 Determinants of the rate of nicotine metabolism and effects on smoking behavior.
16952495 2006 Comprehensive evaluation of variability in nicotine metabolism and CYP2A6 polymorphic alleles in four ethnic populations.
16891249 2006 CYP2A6 polymorphisms in Malays, Chinese and Indians.
16857725 2006 Induction of human CYP2A6 is mediated by the pregnane X receptor with peroxisome proliferator-activated receptor-gamma coactivator 1alpha.
16758265 2006 Characterization of the novel CYP2A6*21 allele using in vivo nicotine kinetics.
16720336 2006 Smoking cessation program and CYP2A6 polymorphism.
16636685 CYP2A7 polymorphic alleles confound the genotyping of CYP2A6*4A allele.
16470306 2006 CYP2A6 and CYP2E1 polymorphisms in a Brazilian population living in Rio de Janeiro.
16452582 2006 Limitation of cigarette consumption by CYP2A6*4, *7 and *9 polymorphisms.
16402128 2006 Impact of CYP2A6 genotype on pretreatment smoking behaviour and nicotine levels from and usage of nicotine replacement therapy.
16402086 CYP2A6 polymorphisms are associated with nicotine dependence and influence withdrawal symptoms in smoking cessation.
16378601 2006 3'-UTR polymorphism in the human CYP2A6 gene affects mRNA stability and enzyme expression.
16377082 2006 Cytochrome P450 2A6 polymorphism in nasopharyngeal carcinoma.
16372023 2005 Ethnic differences in nicotine metabolic rate among New Zealanders.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16272956 2005 CYP2A6, MAOA, DBH, DRD4, and 5HT2A genotypes, smoking behaviour and cotinine levels in 1518 UK adolescents.
16207711 2005 Analysis of coumarin 7-hydroxylation activity of cytochrome P450 2A6 using random mutagenesis.
16176798 2005 Genetic polymorphism of CYP2A6 as one of the potential determinants of tobacco-related cancer risk.
16126166 2005 Generation and characterization of a transgenic mouse model with hepatic expression of human CYP2A6.
16086027 2005 Structures of human microsomal cytochrome P450 2A6 complexed with coumarin and methoxsalen.
16048566 2005 Genetic polymorphisms of cytochrome P450 in patients with hepatitis C virus-associated hepatocellular carcinoma.
16041240 2005 Three haplotypes associated with CYP2A6 phenotypes in Caucasians.
16006997 2005 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of colorectal cancer.
15993850 2005 A novel CYP2A6*20 allele found in African-American population produces a truncated protein lacking enzymatic activity.
15940289 2005 Association of CYP2A6*1B genetic variant with the amount of smoking in French adults from the Stanislas cohort.
15900015 2005 Characterization of novel CYP2A6 polymorphic alleles (CYP2A6*18 and CYP2A6*19) that affect enzymatic activity.
15861044 2005 Ethnic variation in CYP2A6*7, CYP2A6*8 and CYP2A6*10 as assessed with a novel haplotyping method.
15861035 2005 Nicotine metabolism: the impact of CYP2A6 on estimates of additive genetic influence.
15680923 2005 Interactions of mammalian cytochrome P450, NADPH-cytochrome P450 reductase, and cytochrome b(5) enzymes.
15671201 2005 Transcriptional regulation of the human CYP2A6 gene.
15665333 2005 Kinetic analysis of oxidation of coumarins by human cytochrome P450 2A6.
15660270 2005 High prevalence of cytochrome P450 2A6*1A alleles in a black African population of Ghana.
15618701 2002 Twenty one novel single nucleotide polymorphisms (SNPs) of the CYP2A6 gene in Japanese and Caucasians.
15592323 2004 A novel polymorphism of human CYP2A6 gene CYP2A6*17 has an amino acid substitution (V365M) that decreases enzymatic activity in vitro and in vivo.
15564629 2004 Genetically decreased CYP2A6 and the risk of tobacco dependence: a prospective study of novice smokers.
15534625 2005 CYP2A6 genetic polymorphisms and correlation with smoking status in Brazilians.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475735 2004 Ethnic variation in CYP2A6 and association of genetically slow nicotine metabolism and smoking in adult Caucasians.
15469410 2004 Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population.
15454735 2004 Identification of deletion-junction site of CYP2A6*4B allele lacking entire coding region of CYP2A6 in Japanese.
15370155 2004 The genetic basis for smoking behavior: a systematic review and meta-analysis.
15327835 2004 Genetic polymorphisms in three Iranian populations with different risks of esophageal cancer, an ecologic comparison.
15308589 2004 Evaluation of CYP2A6 genetic polymorphisms as determinants of smoking behavior and tobacco-related lung cancer risk in male Japanese smokers.
15225612 2004 Novel human CYP2A6 alleles confound gene deletion analysis.
15203795 2004 A meta-analytic review of the CYP2A6 genotype and smoking behavior.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15039299 2004 Quantitative contribution of CYP2D6 and CYP3A to oxycodone metabolism in human liver and intestinal microsomes.
14981342 2004 Whole deletion of CYP2A6 gene (CYP2A6AST;4C) and smoking behavior.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583682 2003 Decreased coumarin 7-hydroxylase activities and CYP2A6 expression levels in humans caused by genetic polymorphism in CYP2A6 promoter region (CYP2A6*9).
14568264 2003 Cytochrome P450 2A6: a new hepatic autoantigen in patients with chronic hepatitis C virus infection.
12883749 Genetic polymorphisms and susceptibility to esophageal cancer among Chinese population (review).
12844137 2003 Effects of polymorphism in promoter region of human CYP2A6 gene (CYP2A6*9) on expression level of messenger ribonucleic acid and enzymatic activity in vivo and in vitro.
12749606 2003 Association of CYP2A6 gene deletion with cigarette smoking status in Japanese adults.
12721789 2003 Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population.
12708602 2003 Single copy of variant CYP2A6 alleles does not confer susceptibility to liver dysfunction in patients treated with coumarin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445030 2002 Genetic polymorphisms in human CYP2A6 gene causing impaired nicotine metabolism.
12419832 2002 A pharmacogenetic study to investigate the role of dietary carcinogens in the etiology of colorectal cancer.
12406643 2002 CYP2A6 genetic variation and potential consequences.
12325023 2002 Characterization of a novel CYP2A7/CYP2A6 hybrid allele (CYP2A6*12) that causes reduced CYP2A6 activity.
12223434 2002 Genetic polymorphism of CYP2A6 gene and tobacco-induced lung cancer risk in male smokers.
12172220 2002 Characterization of a genotype previously designated as CYP2A6 D-type: CYP2A6*4B, another entire gene deletion allele of the CYP2A6 gene in Japanese.
12164325 2002 Genotype frequencies of 50 polymorphisms for 241 Japanese non-cancer patients.
12162851 2002 Species differences in coumarin metabolism: a molecular modelling evaluation of CYP2A interactions.
12115524 2002 Effects of cytochrome P450 (CYP) 2A6 gene deletion and CYP2E1 genotypes on gastric adenocarcinoma.
11960914 2002 CYP2A6/2A7 and CYP2E1 expression in human oesophageal mucosa: regional and inter-individual variation in expression and relevance to nitrosamine metabolism.
11927840 2002 Variation in coumarin 7-hydroxylase activity associated with genetic polymorphism of cytochrome P450 2A6 and the body status of iron stores in adult Thai males and females.
11805739 2002 Genetic variation in CYP2A6-mediated nicotine metabolism alters smoking behavior.
11725533 2001 Lack of association between smoking and CYP2A6 gene polymorphisms in A Japanese population.
11695850 2001 Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes.
11684323 2001 Comparison of cytochrome P450 2A6 polymorphism frequencies in Caucasians and African-Americans using a new one-step PCR-RFLP genotyping method.
11434509 2001 Nicotine metabolism and CYP2A6 allele frequencies in Koreans.
11278503 2001 CYP2A6*6, a novel polymorphism in cytochrome p450 2A6, has a single amino acid substitution (R128Q) that inactivates enzymatic activity.
11259349 2001 Variable CYP2A6-mediated nicotine metabolism alters smoking behavior and risk.
11241319 2001 Frequency of CYP2A6 gene deletion and its relation to risk of lung and esophageal cancer in the Chinese population.
11237731 2001 A novel single nucleotide polymorphism altering stability and activity of CYP2a6.
11207029 2001 Genetic polymorphisms of cytochrome P450 2A6 in a case-control study on lung cancer in a French population.
11054771 2000 Functional variants at CYP2A6: new genotyping methods, population genetics, and relevance to studies of tobacco dependence.
10781881 2000 CYP2A6: a human coumarin 7-hydroxylase.
10544257 1999 Identification and characterisation of novel polymorphisms in the CYP2A locus: implications for nicotine metabolism.
9890157 1998 Molecular genetics of the human cytochrome P450 monooxygenase superfamily.
9827545 1998 Genotyping of human cytochrome P450 2A6 (CYP2A6), a nicotine C-oxidase.
9409631 1997 A single amino acid substitution (Leu160His) in cytochrome P450 CYP2A6 causes switching from 7-hydroxylation to 3-hydroxylation of coumarin.
8587134 1995 Organization and evolution of the cytochrome P450 CYP2A-2B-2F subfamily gene cluster on human chromosome 19.
7864805 1995 Expression and alternative splicing of the cytochrome P-450 CYP2A7.
7668294 1995 A genetic polymorphism in coumarin 7-hydroxylation: sequence of the human CYP2A genes and identification of variant CYP2A6 alleles.
7581481 1995 The CYP2A gene subfamily: species differences, regulation, catalytic activities and role in chemical carcinogenesis.
4011450 1985 RFLP for a human cytochrome P-450 gene at 19q13.1-qter (HGM8 provisional designation CYPI).
3856261 1985 Isolation and sequence of a human cytochrome P-450 cDNA clone.
2748347 1989 cDNA and deduced amino acid sequences of human P450 IIA3 (CYP2A3).
2726448 1989 Close linkage of the human cytochrome P450IIA and P450IIB gene subfamilies: implications for the assignment of substrate specificity.
2322567 1990 The CYP2A3 gene product catalyzes coumarin 7-hydroxylation in human liver microsomes.
1944238 1991 Purification and characterization of human liver microsomal cytochrome P-450 2A6.
1889415 1991 Isolation and characterization of a cytochrome P450 of the IIA subfamily from human liver microsomes.