Property Summary

NCBI Gene PubMed Count 42
PubMed Score 73.05
PubTator Score 44.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Mouth Diseases 11 0.0 0.0
Obesity 655 0.0 0.0
Disease Target Count
Schizophrenia 1136
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Craniosynostosis 73 3.023 1.5
Disease Target Count Z-score Confidence
Hypervitaminosis A 13 3.412 1.7
Renal agenesis 29 3.165 1.6
DiGeorge syndrome 46 3.025 1.5

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease -2.329 3.0e-02
acute quadriplegic myopathy 1.887 6.1e-08
adult high grade glioma -2.000 5.9e-03
aldosterone-producing adenoma -1.638 2.0e-02
astrocytic glioma -2.800 6.6e-03
Astrocytoma, Pilocytic -1.100 2.6e-02
atypical teratoid / rhabdoid tumor -2.900 9.5e-08
autosomal dominant Emery-Dreifuss muscul... 1.808 3.4e-03
axial spondyloarthropathy 1.200 3.1e-02
breast carcinoma -1.100 2.0e-02
cystic fibrosis 1.200 1.8e-03
ductal carcinoma in situ -2.100 3.8e-04
ependymoma -2.500 1.8e-02
fibroadenoma -2.000 2.2e-02
glioblastoma -1.900 8.7e-05
group 4 medulloblastoma -1.500 2.6e-02
invasive ductal carcinoma -2.100 4.0e-03
juvenile dermatomyositis 1.211 8.3e-05
lung cancer -1.500 1.5e-02
medulloblastoma, large-cell -2.200 2.3e-03
oligodendroglioma -2.100 3.3e-02
Pick disease -1.200 2.9e-02
pituitary cancer -2.400 1.0e-05
primary pancreatic ductal adenocarcinoma -1.007 4.7e-03
psoriasis -1.500 5.7e-07
severe Alzheimer's disease -1.142 5.0e-02
subependymal giant cell astrocytoma -3.529 7.0e-03
ulcerative colitis 1.600 2.1e-02

Protein-protein Interaction (6)

Gene RIF (25)

AA Sequence

MLFEGLDLVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGS      1 - 70
GFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRSTRMLLGPNTVSNSIGDIHRN     71 - 140
KRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHL    141 - 210
FEVYQQFVDNVFSLPVDLPFSGYRRGIQARQILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKE    211 - 280
MTMQELKDGTLELIFAAYATTASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSG    281 - 350
LRYLDCVIKEVMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQA    351 - 420
RSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVLHPVDGLSVKF    421 - 490
FGLDSNQNEILPETEAMLSATV                                                    491 - 512
//

Text Mined References (43)

PMID Year Title