Property Summary

NCBI Gene PubMed Count 49
PubMed Score 287.74
PubTator Score 156.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma -1.100 2.0e-02
medulloblastoma -1.500 6.4e-04
non-small cell lung cancer 1.447 7.5e-06
fibroadenoma 1.400 5.0e-02
inflammatory breast cancer -2.500 2.0e-04
pterygium -1.300 3.4e-03
ovarian cancer 1.100 1.7e-10
chronic rhinosinusitis -2.309 9.1e-03
cystic fibrosis and chronic rhinosinusit... -2.211 2.9e-02
head and neck cancer -2.500 6.8e-03
head and neck cancer and chronic obstruc... -2.300 7.3e-04
psoriasis 1.100 2.0e-04

Protein-protein Interaction (1)

Gene RIF (33)

PMID Text
26058854 CYP26A1-mediated oncogenic characteristics may be partially responsible for the elevated expression of fascin.
25839051 CYP26A1 polymorphisms were associated with increased risk of malignant oral disorders in betel quid chewers.
25541526 Molecular recognition of CYP26A1 binding pockets and structure-activity relationship studies for design of potent and selective retinoic acid metabolism blocking agents has been described.
25492813 In liver microsomes, CYP26A1 plays a role in clearing bioactive retinoids.
25294402 data suggested that CYP26A1 overexpression might contribute to the development and progression of cervical malignancies and squamous neoplasia of the head and neck
24819304 HNF4alpha coordinates with retinoic acid receptors in a retinoic acid-dependent manner to strongly induce CYP26A1 gene expression in the liver, which may explain the high level of response to retinoic acid observed in vivo.
24043786 CYP26 is able to inactivate retinoids in serum, preventing retinoic acid signaling and thus bone-marrow hematopoietic stem cell differentiation.
22179182 Our observation suggests an involvement of enhanced CYP26A1 expression causing a functional vitamin A deficieny state in skin that can potentially lead to neoplastic transformation of keratinocytes in an early phase during skin carcinogenesis
22020119 CYP26A1 and CYP26B1 are qualitatively similar retinoic acid hydroxylases with overlapping expression profiles; CYP26A1 has higher catalytic activity than CYP26B1.
21975512 The promoter region of CYP26A1 is significantly hypermethylated in allergic asthmatic subjects.
21850183 CYP26A1 and CYP26C1 play a pivotal role in the pathogenesis of nonsyndromic bilateral and unilateral optic nerve aplasia.
21521770 Primary metabolites of all-trans-retinoic acid formed by CYP26A1 are identified and the ligand selectivity and ligand interactions of CYP26A1 are characterized.
20693622 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20682464 the functioning of multiple RAREs may account for the strong inducibility of CYP26A1 in liver, which, in turn, may be important physiologically for restoring retinoid homeostasis when the concentration of RA rises.
20513361 CYP26A1 is expressed in human liver microsomes; its expression correlates with retinoic acid hydroxylation.
20375987 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20167577 Observational study of gene-disease association. (HuGE Navigator)
19703508 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19553612 Observational study of gene-disease association. (HuGE Navigator)
19519282 cytochrome P450 family 26 (CYP26) enzymes have a role in determining the cellular exposure to retinoic acid by inactivating retinoic acid in cells that do not need retinoic acid--REVIEW
18992717 Results provide a biochemical framework for CYP26A1 function and offer insight into the role of CYP26A1 as a drug target as well as in fetal development and cell cycle regulation
18059332 Overexpression of CYP26A1 causes intracellular retinoic acid depletion and drives the cell into a highly proliferative and invasive state with induction of other known oncogenes
17460545 Three new alleles termed as CYP26A1*2, CYP26A1*3, and CYP26A1*4, are potentially defective in all-trans retinoic acid metabolism.
17218384 Low CYP26A1 expression may explain high risk of resistance installation, by increase retinoid pressure.
17059167 analysis of CYP26A1 active site architecture and ligand binding
16933217 Observational study of gene-disease association. (HuGE Navigator)
16933217 g.3116delT mutation is of particular interest because it was identified in a patient with spina bifida and likely encodes a truncated protein with no enzymatic activity, as demonstrated by preliminary in vitro data.
16778795 Constitutive expression of CYP26AI in vivo and in organotypic culture was found to be restricted to basal epidermal keratinocytes, as well as eccrine sweat glands and sebaceous glands.
16463413 Variants in CYP26A1 are unlikely to be a major risk factor for caudal regression syndrome; further study with a larger number of genotyped subjects is required.
16463413 Observational study of gene-disease association. (HuGE Navigator)
16194896 induction and regulation of CYP26A1 expression in human intestinal (Caco-2), liver (HepG2), endothelial (HUVEC), and APL (NB4) cell lines
16053444 The identification of a functional retinoic acid response element located 2.0 kb upstream of the Cyp26A1 transcriptional start site is reported.
15281009 increased CYP26-mediated catabolism of retinoic by CRABP-I transfection might decrease the amount of retinoic acid that is accessible to the nuclear receptors

AA Sequence

MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQM      1 - 70
KRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVI     71 - 140
MRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQL    141 - 210
VEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWE    211 - 280
RGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEIL    281 - 350
EQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM    351 - 420
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARF    421 - 490
THFHGEI                                                                   491 - 497
//

Text Mined References (50)

PMID Year Title
26937021 2016 Identification of Tazarotenic Acid as the First Xenobiotic Substrate of Human Retinoic Acid Hydroxylase CYP26A1 and CYP26B1.
26058854 2015 The retinoic acid-metabolizing enzyme CYP26A1 upregulates fascin and promotes the malignant behavior of breast carcinoma cells.
25839051 2015 Association study between novel CYP26 polymorphisms and the risk of betel quid-related malignant oral disorders.
25541526 2015 Molecular recognition of CYP26A1 binding pockets and structure-activity relationship studies for design of potent and selective retinoic acid metabolism blocking agents.
25492813 2015 Induction of CYP26A1 by metabolites of retinoic acid: evidence that CYP26A1 is an important enzyme in the elimination of active retinoids.
25294402 2014 Increased expression of the retinoic acid-metabolizing enzyme CYP26A1 during the progression of cervical squamous neoplasia and head and neck cancer.
24819304 2014 Hepatocyte nuclear factor 4? (HNF4?) in coordination with retinoic acid receptors increases all-trans-retinoic acid-dependent CYP26A1 gene expression in HepG2 human hepatocytes.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24043786 2013 Regulation of human hematopoietic stem cell self-renewal by the microenvironment's control of retinoic acid signaling.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
22179182 2011 Enhanced expression of retinoic acid-metabolizing enzyme CYP26A1 in sunlight-damaged human skin.
22020119 2012 Comparison of the function and expression of CYP26A1 and CYP26B1, the two retinoic acid hydroxylases.
21975512 2011 Epigenetic changes in B lymphocytes associated with house dust mite allergic asthma.
21850183 2011 Nonsyndromic bilateral and unilateral optic nerve aplasia: first familial occurrence and potential implication of CYP26A1 and CYP26C1 genes.
21521770 2011 Substrate specificity and ligand interactions of CYP26A1, the human liver retinoic acid hydroxylase.
20693622 2010 CYP46A1 functional promoter haplotypes decipher genetic susceptibility to Alzheimer's disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20682464 2010 Multiple retinoic acid response elements cooperate to enhance the inducibility of CYP26A1 gene expression in liver.
20513361 2010 The relative importance of CYP26A1 in hepatic clearance of all-trans retinoic acid.
20375987 2010 A human ALDH1A2 gene variant is associated with increased newborn kidney size and serum retinoic acid.
20167577 2010 Analysis of lipid pathway genes indicates association of sequence variation near SREBF1/TOM1L2/ATPAF2 with dementia risk.
19703508 2009 Positive association between ALDH1A2 and schizophrenia in the Chinese population.
19553612 2009 Primary open-angle glaucoma: association with cholesterol 24S-hydroxylase (CYP46A1) gene polymorphism and plasma 24-hydroxycholesterol levels.
19519282 2009 The role of CYP26 enzymes in retinoic acid clearance.
18992717 2009 Expression and functional characterization of cytochrome P450 26A1, a retinoic acid hydroxylase.
18059332 2008 A novel role for the retinoic acid-catabolizing enzyme CYP26A1 in Barrett's associated adenocarcinoma.
17460545 2007 The discovery of new coding alleles of human CYP26A1 that are potentially defective in the metabolism of all-trans retinoic acid and their assessment in a recombinant cDNA expression system.
17218384 2007 Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity.
17059167 2006 Homology model of human retinoic acid metabolising enzyme cytochrome P450 26A1 (CYP26A1): active site architecture and ligand binding.
16933217 2006 Evidence for a functional genetic polymorphism of the human retinoic acid-metabolizing enzyme CYP26A1, an enzyme that may be involved in spina bifida.
16778795 2006 Skin retinoid concentrations are modulated by CYP26AI expression restricted to basal keratinocytes in normal human skin and differentiated 3D skin models.
16463413 2006 Mutational screening of the CYP26A1 gene in patients with caudal regression syndrome.
16194896 2005 Regulation of a highly specific retinoic acid-4-hydroxylase (CYP26A1) enzyme and all-trans-retinoic acid metabolism in human intestinal, liver, endothelial, and acute promyelocytic leukemia cells.
16053444 2005 Transcriptional co-operativity between distant retinoic acid response elements in regulation of Cyp26A1 inducibility.
15281009 2004 The effect of cellular retinoic acid binding protein-I expression on the CYP26-mediated catabolism of all-trans retinoic acid and cell proliferation in head and neck squamous cell carcinoma.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532297 2004 A novel human cytochrome P450, CYP26C1, involved in metabolism of 9-cis and all-trans isomers of retinoic acid.
12727970 2003 Coordinate regulation of the production and signaling of retinoic acid by estrogen in the human endometrium.
10976925 2000 Cytochrome P450RAI(CYP26) promoter: a distinct composite retinoic acid response element underlies the complex regulation of retinoic acid metabolism.
10874126 2000 Identification of human cytochrome P450 isoforms that contribute to all-trans-retinoic acid 4-hydroxylation.
10823918 2000 Identification of the human cytochrome P450, P450RAI-2, which is predominantly expressed in the adult cerebellum and is responsible for all-trans-retinoic acid metabolism.
10583049 1999 Cytochrome P450, CYP26AI, is expressed at low levels in human epidermal keratinocytes and is not retinoic acid-inducible.
9826557 1998 Expression of cytochrome P450RAI (CYP26) in human fetal hepatic and cephalic tissues.
9716180 1998 Human retinoic acid (RA) 4-hydroxylase (CYP26) is highly specific for all-trans-RA and can be induced through RA receptors in human breast and colon carcinoma cells.
9521883 1998 P450RAI (CYP26A1) maps to human chromosome 10q23-q24 and mouse chromosome 19C2-3.
9228041 1997 CYP26, a novel mammalian cytochrome P450, is induced by retinoic acid and defines a new family.
9228017 1997 cDNA cloning of human retinoic acid-metabolizing enzyme (hP450RAI) identifies a novel family of cytochromes P450.
8601734 1996 Retinoic acid isomers applied to human skin in vivo each induce a 4-hydroxylase that inactivates only trans retinoic acid.