Property Summary

Ligand Count 34
NCBI Gene PubMed Count 437
PubMed Score 2096.33
PubTator Score 1808.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
psoriasis 6694 5.5e-46
ovarian cancer 8520 2.7e-07
osteosarcoma 7950 2.4e-05
medulloblastoma, large-cell 6241 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.2
substance-related disorder 162 0.0 2.2

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.9e-03
osteosarcoma 1.197 2.4e-05
ovarian cancer -1.400 2.7e-07
psoriasis -4.700 5.5e-46

Protein-protein Interaction (4)

Gene RIF (449)

AA Sequence

MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKNPHLALSRMSQ      1 - 70
RYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDGQSLTFSTDSGPVWAARRRLA     71 - 140
QNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELMAGPGHFDPYNQVVVSVANVIGAMCFGQHFP    141 - 210
ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSV    211 - 280
RDITGALFKHSKKGPRASGNLIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTV    281 - 350
IGRERRPRLSDRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL    351 - 420
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVPPGVKVD    421 - 490
LTPIYGLTMKHARCEHVQARRFSIN                                                 491 - 515
//

Text Mined References (441)

PMID Year Title