Property Summary

NCBI Gene PubMed Count 692
PubMed Score 2408.95
PubTator Score 1509.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count P-value
ovarian cancer 8297 3.0e-09
adrenocortical adenoma 127 4.7e-03
interstitial cystitis 2237 2.6e-02
adrenocortical carcinoma 1385 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Breast cancer 3469 6.555 3.3
Alzheimer's disease 640 0.0 3.0
Disease Target Count Z-score Confidence
Pseudohermaphroditism 14 0.0 4.0
Disease Target Count
AROMATASE EXCESS SYNDROME 1

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical adenoma -1.748 4.7e-03
adrenocortical carcinoma -1.429 2.9e-02
interstitial cystitis 1.500 2.6e-02
ovarian cancer -1.100 3.0e-09

Protein-protein Interaction (4)

Gene RIF (734)

AA Sequence

MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGI      1 - 70
GSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPEL     71 - 140
WKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDE    141 - 210
SAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFAT    211 - 280
ELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDI    281 - 350
QKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK    351 - 420
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEM    421 - 490
IFTPRNSDRCLEH                                                             491 - 503
//

Text Mined References (698)

PMID Year Title