Property Summary

NCBI Gene PubMed Count 486
PubMed Score 1166.96
PubTator Score 1117.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1795 3.2e-02
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0
Parkinson's disease 364 0.0 2.0
Disease Target Count
Adrenal hyperplasia 5 1

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.060 3.2e-02

Protein-protein Interaction (2)

Gene RIF (498)

PMID Text
26973185 Interaction of novel oxazoline derivatives of 17(20)e-pregna-5,17(20)-diene with cytochrome P450 17A1
26940238 CYP17A1 rs3824755 and rs743572 are associated with Alzheimer's disease in the Chinese Han population and act in combination with APOE e4.
26902494 Polymorphism single nucleotide of CYP17A1 gene is implicated to the development of high blood pressure.
26719338 The FMN domain outcompetes b5 for binding to CYP17A1 in the three-component system
26668369 Data indicate that cytochrome P450 17A1 (CYP17A1) first catalyzes pregnenolone (PREG) and then converts the 17-hydroxypregnenolone initial product to dehydroepiandrosterone, a process representing the first committed step in the biosynthesis of androgens.
26634548 ESR1 may be associated with low mineral osseous densitometry, while CYP17 and COMT gene polymorphisms were not associated with mineral osseous densitometry.
26587646 We conclude that cytochrome b5 can influence the electronic conductivity of cytochrome P450c17 via allosteric, protein-protein interactions.
26414697 genetic variants in the androgen-related genes CYP17A1 and JMJD1C might be associated with risk of Barrett's esophagus (BE) and esophageal adenocarcinoma (EAC).
26407154 Our study suggests no strong association between the CYP17A1 T27C and LEP -2548G>A polymorphisms and the incidence of breast cancer in Turkish women.
26345865 The compound heterozygous mutation of p. Thr101Ilefs*2 and p. Thr306Ale is a new gene mutation of 17alpha-hydroxylase/17, 20-lyase deficiency.
26263970 Thus, CYP17A1 may contribute to cardiac hypertrophy in this clinical condition.
26225710 Cytochrome-17 Gene Polymorphism is associated with Risk of Gall Bladder Stones and Cancer.
26025587 To this end, we have investigated the effects on structural characteristics in the presence of the membrane for CYP17A1.
26002733 Acyl-Carbon Bond Cleaving Cytochrome P450 Enzymes: CYP17A1, CYP19A1 and CYP51A1.
25990650 The present meta-analysis confirmed the significant association between a polymorphism of the CYP17A1 gene and hypertension susceptibility.
25929975 data confirm a sex-dependent allele distribution of the CYP17 MspA1 polymorphism in the transsexual population, female-to-male> male-to-female, suggestive of a hypothetical A2 involvement in transsexualism
25917616 study is the first to our knowledge to show that polymorphisms in the rs1004467 SNP of CYP17A1 and rs3813865 SNP of CYP2E1 correlate with susceptibility to HAPC
25897673 CNVs of AR and CYP17A1 genes would appear to be associated with outcome of CRPC patients treated with abiraterone.
25889125 SNPs rs1004467, rs4919687 and rs10786712 associated with coronary artery disease in Han population of China
25765894 A partial CYP17A1 deletion in a Kurdish family with Steroid 17alpha-hydroxylase deficiency, was characterized.
25719302 CYP17A1 mutation is associated with 17alpha-Hydroxylase/17-20 lyase deficiency leading to congenital adrenal hyperplasia.
25697092 New, recurrent, and prevalent mutations have been characterized in 26 Chinese patients with 17alpha-hydroxylase/17,20-lyase deficiency.
25650406 W121R substitution, affecting the first residue in the conserved heme-interacting WXXXR motif of CYP17A1, is associated with partial combined deficiency of 17alpha-hydroxylase/17,20-lyase
25592814 The aim of the present study was to assess the association between CYP17A1 gene polymorphism and coronary artery disease in a Chinese Uygur population.
25514466 P450c17 and AKR1C3 inhibition may be an effective combinatorial treatment strategy.
25448501 Studied the hypothesis that the CYP17 variant affected the relationship between anthropometric measurements and salivary estradiol in healthy women in the United States.
25386927 substrate modification studies have revealed occult epoxidase and 21-hydroxylase activities of CYP17A1, and the fraction of epoxide formed correlated with the 16alpha-hydroxylase activity of the enzymes
25337833 Genetic variants of CYP17A1 and CYP3A4 may play a role in the development of prostate cancer in Korean men.
25323563 The study suggests that the CYP17 rs743572 polymorphism might modify the risk of prostate cancer in the subjects of African decent (meta-analysis).
25315771 Two acidic residues, Glu-48 and Glu-49, of cytochrome b5 are essential for stimulating the 17,20-lyase activity of CYP17A1.
25301938 Data suggest that understanding the cytochrome P450 17A1 (CYP17A1) mechanism provides information for better targeted drug design.
25251696 Molecular docking studies demonstrated quite similar binding patterns of all new pregnenolone derivatives at the active site of CYP17 through hydrogen bonding and hydrophobic interaction.
25208301 The CYP17A1 gene -34T/C polymorphism might not be directly correlated with polycystic ovary syndrome, but might influence PCOS via the association of testosterone level and the HOMA-IR.
25150952 There was no difference in the distribution of the CYP1A1 Mspl (p = 0.86) and CYP17 genotypes (p = 0.12) between the precocious puberty and normal puberty groups.
25064838 Higher organochlorine pesticide levels and the A1A1 genotype of CYP17A1 in pregnant women may be considered as important aetiological factors in idiopathic small for gestational age.
25030786 These results suggested that both CYP17A1 and ESR1 polymorphisms may modulate the effects of phthalate exposure on the development of leiomyoma.
25012481 The results of this study suggest that the CYP17 A2 allele influences AD susceptibility in a sex-specific way by acting not only on AD risk but also on the age at disease onset, an important parameter of AD severity.
24875910 Data of genetic polymorphism of CYP1A1, CYP1B1 and CYP17 are presented. The association of the gene polymorphisms and organochlorine pesticide blood levels in benign prostatic hyperplasia patients is explored.
24714196 17alpha-hydroxylase deficiency diagnosed in early infancy caused by a novel mutation of the CYP17A1 gene
24687554 CYP17 rs743572 is associated with increased risk of GBC in tobacco users in the North Indian population. However, the study requires confirmation in other populations.
24681790 Findings do not support hypothesis that genetic variation of promoter of the CYP17 gene is an important contributing factor in the etiology of premature Coronary artery disease or occurrence of Myocardial Infarction in the Caucasian Greek population.
24671419 backbone conformations for certain structural features of the human steroidogenic cytochrome P450 17A1
24629213 The BRCA1 founder mutation and polymorphisms in CYP1A1 and CYP17 can increase the breast cancer risk among Inuit women, and the risk increases with higher serum levels of perfluorooctane sulfonate and perfluorooctanoic acid.
24597476 In China, 5 mutations in CYP17A1 are identified in three 46, XY females with combined 17alpha-hydroxylase/17, 20-lyase deficiency of varying severity; in silico analysis explains conformational changes of CYP17A1 with missense mutations. [CASE REPORT]
24485502 [review] Mutations that compromise all CYP17A1 activities are extremely rare, causing mutations that compromise all CYP17A1 activities are extremely rare, causing combined 17-hydroxylase/17,20-lyase deficiency.
24430361 SNPs in ESR1 (rs2234693), ESR2 (rs2987983), CYP17A1 (rs743572), and CYP19A1 (rs700519) indeed contribute to breast cancer susceptibility among North Indian women.
24389397 Although an association between the CYP17 CC genotype and TD is indicated, our findings do not support the hypothesis that this is mediated through increased DHEA(S) levels.
24299954 The unique response of CYP17A1 lyase activity to mutation of Thr306 is consistent with a reactive intermediate formed independently of proton delivery in the active site, and supports involvement of a nucleophilic peroxo-anion rather than the traditional Compound I in catalysis.
24244276 the CYP11A1, CYP17A1, HSD3B2, SRD5A2, and HSD17B6 mRNA levels in metastases were significantly lower.
24160919 The results strongly suggest that the P450 CYP17A1 reactive intermediate involved in this latter step is an iron-bound ferric peroxoanion.
24140493 CYP17A1 promoter polymorphism (rs17115149, -600C>A) is a functional regulatory SNP which associated with its expression possibly by epigenetic pathway, which may signify a genetic risk factor for male infertility.
24140098 The novel p.W406L mutation caused a complete loss of both catalytic activities, indicating that this amino acid is critical for P450c17 function.
24014605 LHCGR and 17alpha-hydroxylase/17-20-lyase (CYP17A1) protein levels are increased in polycystic ovaries (PCOs).
23888338 The meta-analysis suggests that the CYP17 MspA1 polymorphism is unlikely to increase the risk of prostate cancer in a wide population. [meta-analysis]
23836902 p38alpha phosphorylates P450c17 in a fashion that confers increased 17,20 lyase activity.
23809139 The CYP17 -34 G variant, previously associated with increased 17beta-estradiol production, displayed a contribution to stage I-II endometriosis in women from a Polish population.
23775394 We found that a common CYP17A1 haplotype (H1) was associated with higher anxiety in AN patients (Clinical Global Impression; CGI-anxiety >/=4)
23759979 In Chinese children, no association of CSK rs1378942, MTHFR rs1801133, CYP17A1 rs1004467, STK39 rs3754777 and FGF5 rs16998073 with BP/risk of hypertension.
23649771 Meta-analysis demonstrates that the C allele of -34T>C in CYP17 is a protective factor associated with decreased endometrial cancer susceptibility, but these associations vary in different ethnic populations.
23621184 The results of the study support a possible role of the A2 allele polymorphism of the CYP17 gene in sporadic prostate cancer development in Iran.
23620596 CYP17A1/b5 interaction is stronger when the hydroxylase substrate pregnenolone is present in the CYP17A1 active site than when the lyase substrate 17alpha-hydroxypregnenolone is in the active site.
23609033 CYP17A1 T-34C polymorphism might not be one risk factor in the carcinogenesis of endometrial cancer.
23586722 CYP17 plays role in the metabolism of 7-dehydrosteroids.
23551929 Data suggest that substrate specificity of CYP17A1 extends to two fluorescent probes (Nile Red and 25-NBD-cholesterol); studies include molecular docking of these substrates at active site of CYP17A1.
23467202 SNP rs11191548, near the CYP17A1 gene, was associated with hypertension and systolic blood pressure in a Chinese Han population.
23350368 The article reviews the relationship between polymorphism of sex hormone-related genes (CYP17, CYP19, CYP1A1, COMPT, ERalpha, ERbeta and others).
23291414 A novel mutation of CYP17A1 gene from five Chinese 17alpha-hydroxylase/17, 20-lyase deficiency patients.
23257735 low ratio of cytochrome P450 family 17/3 beta-hydroxysteroid dehydrogenase type II with high expression of 11-beta-monooxygenase seems to explain steroidogenic characteristics of aldosterone-producing adenomas
23229009 No association between the studied CYP17 or CYP19 polymorphisms and age at menopause was found in Polish women.
23133444 genetic association study in population in Republic of Korea: Data suggest that an SNP in CYP17A1 (rs1004467) is associated with arterial stiffness (i.e., prehypertension; development of hypertension) in subjects with prediabetes or type 2 diabetes.
23129512 Overall, the CYP17 heterozygous and homozygous variants were not associated with prostate cancer, but they confer a 60% increased risk in a sub-group analysis restricted to African-American men.
23036723 Identification of a novel mutation in CYP17A1 gene
23015357 Single nucleotide polymorphisms in CYP17A1 was associated with pancreatic cancer.
22959498 Meta-analysis indicated significant associations of both CYP17A1 rs11191548 and FGF5 rs16998073 polymorphisms with hypertension susceptibility in East Asians.
22954317 Analysis of the CYP17A1 gene in our Chinses patients revealed 12 different kinds of mutation.
22951291 The 5alpha-reductase is the gatekeeper of the backdoor pathway, whereas the 17,20-lyase activity of CYP17A1 is the regulator of the flux through the androgen pathways
22873692 CYP17A1 has progesterone 21-hydroxylase activity and human CYP21A2 has progesterone 16alpha-hydroxylase activity
22714708 4 polymorphic mutations of the CYP17A1 gene were significantly associated with the responsiveness to long-term androgen deprivation therapy in castration-resistant prostate cancer in Japanese men.
22653668 The CYP17 gene has an effect on obesity in the Caucasian population.
22528335 Our study did not provide support for the hypothesized relationship between CYP17 and PSA gene polymorphisms and prostate cancer in the Slovak male population.
22456087 A trend of the MspAI polymorphism of the gene CYP17 to act as a protective factor against the development of breast cysts.
22434081 p450c17 was detected in dorsal root ganglia and spinal cord.
22419734 The CYP17 rs2486758 minor allele may predispose to higher 17beta-estradiol levels, particularly in premenopausal women with a high clustered metabolic score.
22331461 No association was found between CYP17 polymorphisms and lung cancer in Singapore Chinese women.
22309630 A description of two Mexican mestizo female siblings, with congenital adrenal hyperplasia due to 17alpha-hydroxylase deficiency caused by a mutation in exon 4 of the CYP 17 gene, that resulted in a stop codon truncating 17OHD.
22266943 X-ray crystal structures of CYP17A1, which were obtained in the presence of either abiraterone or TOK-001
22238371 genetic association studies in population of women in Alabama: Data suggest that genetic variations in CYP17A1 and HSD11B1 are not major risk factors for polycystic ovary syndrome; 4 SNP in CYP17A1 and 8 SNP in HSD11B1 were investigated.
22237020 This meta-analysis suggests that the CYP17 T/C polymorphism may be not associated with polycystic ovary syndrome (PCOS) risk, while the observed increase in risk of PCOS may be due to small-study bias.[meta-analysis]
22217842 Presentation of ten different mutations found in CYP17 structural genes of 20 individuals having impaired CYP17 activities. [REVIEW]
22174412 Direct regulation of androgen receptor activity by potent CYP17 inhibitors in prostate cancer cells.
22103881 The mutation is a microdeletion, located in exon 8, Asp487-Ser488-Phe489 deletion. This deletion may be a prevalent CYP17 mutation in the Chinese population.
22072737 The syndrome of 17,20 lyase deficiency.
22071413 Polymorphisms in the CYP17A1 and NT5C2 genes influence a reduction in both visceral and subcutaneous fat mass in Japanese women.
22066265 Electrochemical reduction of CYP17A1 may serve as an adequate substitution of the reconstituted system which requires additional redox partners - for the exhibition of catalytic activity of hemoproteins of the cytochrome P450 superfamily.
22057025 This study demonistrated that the variance of CYP17 and CYP19 can in fl uence the development of Alzheimer's disease in the high-risk group of womenwith down syndrome.
22048715 There is a sex-specific effect of the CYP17A1 single nucleotide polymorphism rs11191548 on blood pressure in Chinese children.
22001566 When incubated with microsomes from yeast expressing human CYP21A2 or CYP17A1 with P450-oxidoreductase, CYP21A2 metabolized 17-fluoroprogesterone to a single product, whereas incubations with CYP17A1 gave no products
21966534 The IVS1 +2T>C mutation abolished most 17alpha-hydroxylase/17, 20-lyase enzyme activity by aberrant mRNA splicing to an intronic pseudo-exon, causing a frame shift and early termination.
21963141 Genetic variations in CYP17A1, CACNB2 and PLEKHA7 were related to blood pressure traits and/or hypertension in Chinese She population.
21948762 CYP17 and CYP19 gene polymorphisms were found to be associated with osteoporosis in postmenopausal women in Turkey.
21919858 The CYP17 T34C polymorphism may not be associated with prostate cancer. (Meta-analysis)
21896988 CYP17A1 polymorphism may be associated with multiple uterine leiomyomas (ULM) but not with all ULM. The future research might enable us to predict the course of the disease. [meta-analysis]
21868758 Anderogen receptor activity in castration-resistant VCaP tumor xenografts can be restored through CYP17A1-dependent de novo androgen synthesis.
21848792 CYP17 is overexpressed in subclinical cortisol-producing adenomas and its overexpression accounts for the increased production of cortisol
21676446 although a polymorphism in the CYP17 gene may not be associated with 17beta-E2 and T concentrations in hypospadias cases, low levels of T and higher E2/T ratio might possibly act as risk factors for hypospadias
21656827 Meta-analysis suggests that CYP17 polymorphism rs743572 is associated with prostate cancer risk in black population, but not in Caucasian or Asian populations.
21644229 CYP17 gene and ERalpha gene may not be genetic risk factors for endometriosis among southern women in China
21511288 As androgens have a significant role in the development of the male urethra, we sought to investigate CYP17-A1/A2 in relation to hypospadias. CYP17-A1/A2 genotypes did not show any significant results
21420394 two mutations are major causes of 17alpha-hydroxylase deficiency in Chinese Han population
21338212 CYP17A1 gene polymorphism is associated with development of breast cancer.
21307141 We have demonstrated CYP17 mRNA and protein expression and activity in human trophoblasts
21300759 Data show that the L858R mutation of EGFR is associated with SNP of estrogen biosynthesis and metabolism genes CYP17, CYP19A1, ERalpha, and COMT in never-smoking female lung adenocarcinoma patients.
21193363 CYP17 gene polymorphism is associated with prostate cancer susceptibility.
21094112 Authros evaluated differences between HFPC and sporadic cancers, in the pattern of common single-nucleotide polymorphisms in CYP17A1.
21045733 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20886547 CYP17 is upregulated in endometrial cancers.
20884100 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20852445 Variants in or near FGF5, CYP17A1 and MTHFR contributed to variation in BP and hypertension risk. Effect sizes of these three loci tended to be larger in Chinese than in white Europeans
20852445 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20798986 there was no association of the -34 T > C CYP17 polymorphism with either breast or ovarian cancer risk in BRCA1 or BRCA2 mutation carriers
20798986 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20729792 The relationships between COMT and CYP17A1 polymorphisms and the risk of preeclampsia, were studied.
20729792 Observational study of gene-disease association. (HuGE Navigator)
20729390 Observational study of gene-disease association. (HuGE Navigator)
20728566 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20720262 discussion of factors controlling expression of CYP17 and hence androgen production in the human body [REVIEW]
20716560 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20650774 The presence of base substitution in androgen-related CYP17 gene at -34 bp (T-->C) increases the risk of post adolescent acne in female subjects with increased androgen levels.
20650774 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628746 Polymorphisms of CYP17 were not associated with any subtype of urinary incontinence.
20628746 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619364 Studies indicate that, depending on CYP17 activity, the steroid hormone biosynthesis pathway is directed to either the formation of mineralocorticoids and glucocorticoids or sex hormones.
20595043 The CYP17 molecule in this model is in the form of a triangular prism, with an edge of approximately 55 A and a thickness of approximately 37 A. It is predominantly helical, comprising 13 alpha helices interspersed by six 3(10) helices and 11 beta-sheets
20539301 CYP17 gene expression may influence growth during childhood and adolescence.
20534731 Starvation and cAMP stimulation regulate P450c17 phosphorylation differentially and an increase in P450c17 phosphorylation does not necessarily lead to enhanced enzyme activity and androgen production.
20503394 Observational study of gene-disease association. (HuGE Navigator)
20479155 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20432167 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20414254 Observational study of gene-disease association. (HuGE Navigator)
20381444 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20214802 Observational study of gene-disease association. (HuGE Navigator)
20207836 Data show that human FOXL2 and SF-1 proteins interact in human granulosa cells and that FOXL2 negatively regulates the transcriptional activation of a steroidogenic enzyme, CYP17, by SF-1.
20200332 Observational study of gene-disease association. (HuGE Navigator)
20197673 2 patients with the phenotypical spectrum of P450c17 deficiency. Three novel mutations in the CYP17A1 gene were identified and their functional characterization provided a good phenotype-genotype correlation.
20193327 CYP17 (T1931C) and HSD17beta1 (A1954G) polymorphisms may jointly increase the risk of breast cancer.
20193327 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20184498 Observational study of gene-disease association. (HuGE Navigator)
20173016 Observational study of gene-disease association. (HuGE Navigator)
20171624 Women with solitary uterine leiomyoma mostly resembled healthy control subjects, whereas women with multiple leiomyomas differed in CYP17A1 AA genotype and external stimuli.
20171624 Observational study of gene-disease association. (HuGE Navigator)
20133979 Carrying the A2 allele of CYP17 supported the increased risk of breast cancer in the C allele carriers of CYP19.
20113968 Polymorphisms within the CYP17 gene is associated with endometriosis.
20113968 Observational study of gene-disease association. (HuGE Navigator)
20099974 Observational study of gene-disease association. (HuGE Navigator)
20086173 Data indicate that enzymes CYP17A1 and HSD3B1 showed low expression, while AKR1C3 and SRD5A1 were abundantly expressed.
20072949 The T/C polymorphism of CYP17 gene may be associated with the incidence of breast cancer in women from Lodz region of Poland.
20072949 Observational study of gene-disease association. (HuGE Navigator)
20069306 Observational study of gene-disease association. (HuGE Navigator)
20043997 Single amino acid substitution (Ala105Leu) changes ratio of 17alpha-hydroxylase activity to 16alpha-hydroxylase activity. Study includes regional sequence alignment with 17 species, structural model of active site, and putative interaction with cyto b5.
20043206 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20033766 The meta-analysis strongly suggests that CYP17 MspA1 polymorphism is not associated with increased breast cancer risk even in the subgroup analyses by ethnicity, menopausal status and source of controls.
20033766 Meta-analysis of gene-disease association. (HuGE Navigator)
20013047 This meta-analysis strongly suggests that CYP17 T-34C polymorphism is not associated with breast cancer risk.
20013047 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19954068 CYP17 polymorphism might be associated with a high risk of prostate cancer.
19954068 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19863350 Observational study of gene-disease association. (HuGE Navigator)
19850690 c-fos may be one of the factors responsible for CYP17 repression and hence suppression of androstenedione production in granulosa cells
19805543 Data support the formation of P450c17, P450arom, and CPR homodimers and oligomers in lipid bilayers.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19672705 Current estrogen monotherapy users had a significantly increased breast cancer risk for duration of use per 5-year increment if they carried CYP17A1_-34_TC. This genotype may increase postmenopausal breast cancer risk in users of estrogen monotherapy.
19672705 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19642097 The CYP17A1 A2 allele may be associated with a lower risk of pancreatic cancer in both men and women.
19642097 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19636199 Homozygous missense mutation of CYP17A1 gene is associated with primary amenhorrea, late onset hypertension,and hypokalemic myopathy
19627379 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19598235 CYP17A1 gene is associated with autistic traits, empathy and Asperger syndrome.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19574343 Observational study of gene-disease association. (HuGE Navigator)
19508587 carriers of D487_F489 deletion in exon 8 or Y329fs in exon 6 who lack apparent clinical symptoms exhibit decreased adrenal 17alpha-hydroxylase activity and altered adrenal gland reserve for steroid biosynthesis
19505920 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19469636 suggest that the CYP17 TT/CC genotype is associated with decreased risk for breast cancer, especially in post menopausal women.
19469636 Observational study of gene-disease association. (HuGE Navigator)
19454579 analysis of structural & functional consequences of 3 novel(A174E, V178D& L465P) & 1 previously reported (R440C) CYP17A1 mutation found in 3 patients with steroid 17alpha-hydroxylase deficiency (17OHD); described missense mutations result in severe 17OHD
19453261 Observational study of gene-disease association. (HuGE Navigator)
19443382 A2 allele of the CYP17 polymorphism is associated with an increased risk of prostate cancer and has a role in the development of prostate cancer in smokers and non-vegetarians
19430483 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19430479 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19415745 Single nucleotide polymorphisms in the CYP17 is Associated with premenopausal breast cancer women.
19415745 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19387820 Observational study of gene-disease association. (HuGE Navigator)
19379515 Results show that genetic polymorphisms in biotransformation enzymes CYP17, GSTP1, PON1 and GLO1 could be associated with the risk for breast cancer.
19379515 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19330259 Observational study of gene-disease association. (HuGE Navigator)
19267349 CYP17A1 is a crucial enzyme for de novo androgen synthesis within the tumor microenvironment after removal of testicular androgens by castration
19174490 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19127255 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
19064581 No association between CYP17 polymorphisms and risk for hepatocellular carcinoma.
19064581 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
19015200 Observational study of gene-disease association. (HuGE Navigator)
19013303 Pesence of this gene defect in PCOS patients seems to be associated with increase in body weight, abdominal adiposity, and metabolic components.
19013303 Observational study of gene-disease association. (HuGE Navigator)
18980759 Observational study of gene-disease association. (HuGE Navigator)
18957719 CYP17 MspA1 polymorphism was not a significant independent risk factor of age at menarche.
18957719 Observational study of gene-disease association. (HuGE Navigator)
18930188 CYP17 gene polymorphism in women affected with endometriosis.
18930188 Observational study of gene-disease association. (HuGE Navigator)
18820009 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18781485 The results of this study suggest that the CYP17 MspAI polymorphism was not significantly associated with an increased risk of reporting hot flushes.
18767927 Observational study of gene-disease association. (HuGE Navigator)
18725155 Our study carried out in a defined group of Indian women with PCOS suggests for the first time an individual, as well as combined, association of polymorphisms in CYP11A1 and CYP17 promoters with T levels.
18725155 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18722876 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18707589 Functional characterization of mutant forms of human CYP17.
18682255 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18645709 findings suggest that the cytochrome P450c17alpha enzyme (CYP17) gene polymorphism studied is unlikely to be associated with risk for uterine leiomyoma in Brazilian women
18645709 Observational study of gene-disease association. (HuGE Navigator)
18636181 Data show that the frequency of seven single nucleotide polymorphisms of CYP17A1 studied had no significant association with polycystic ovary syndrome, but one haplotype may be associated with the pathogenesis of PCOS in a Korean population.
18636181 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18629629 Genetic polymorphisms of CYP17 are associated with breast cancer.
18629629 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18619494 The present study thus suggests that the -34T/C polymorphism of the CYP17 gene affects personality traits of healthy males, but not females, and this gender-dependent effect may be mediated by the action of sex hormones such as estradiol and testosterone.
18619494 Observational study of gene-disease association. (HuGE Navigator)
18618215 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18601603 present findings suggest that CYP17A1, CYP19, and androgen receptor polymorphisms are unlikely to be associated with an increased risk of uterine leiomyomas in Brazilian women
18601603 Observational study of gene-disease association. (HuGE Navigator)
18593984 Observational study of gene-disease association. (HuGE Navigator)
18560445 no association was detected between CYP17 and human height.
18560445 Observational study of gene-disease association. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18505908 Data show that CYP17A1 were expressed mainly in the zona fasciculata (ZF), followed by the zona reticularis in adrenal cortex attached to adrenocortical adenomas.
18503826 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18501301 Observational study of gene-disease association. (HuGE Navigator)
18499961 Observational study of gene-disease association. (HuGE Navigator)
18496127 Studied the genetic aspects of epitestosterone formation. Data indicate that 5-androstene-3beta, 17alpha-diol is an important precursor of epitestosterone and that CYP17 is involved in its production.
18496127 Observational study of gene-disease association. (HuGE Navigator)
18495332 Observational study of gene-disease association. (HuGE Navigator)
18491956 Observational study of gene-disease association. (HuGE Navigator)
18483327 CYP17A1 single nucleotide polymorphism is not associated with the risk of breast cancer or fibrocystic breast disease in Chinese women.
18483327 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18437511 For CYP17A1 (cytochrome P450 family 17 subfamily A polypeptide 1)risk of endometrial cancer was somewhat lower among women with the C/C genotype at T-34C (rs743572)
18437511 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18422032 Nonsense mutation in cytochrome P450c17 causes complete combined 17alpha-hydroxylase/17,20-lyase deficiency
18415690 Observational study of gene-disease association. (HuGE Navigator)
18411914 The age of menarche in population of Polish girls is not associated with the polymorphism of CYP 17 gene.
18411914 Observational study of gene-disease association. (HuGE Navigator)
18318428 Observational study of gene-disease association. (HuGE Navigator)
18305346 Observational study of gene-disease association. (HuGE Navigator)
18299473 In the homozygous patients for CYP17A1 E305G, both serum and urinary steroids showed a severe lack of androgens (C(19)-steroids) pointing to the absence of 17,20-lyase activities
18281250 CYP17 variant C allele may increase breast cancer risk in conjunction with long-term estrogen replacement use and high body mass index in postmenopausal women.
18281250 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18262808 The CYP17 mRNA and androstenedione production of theca cells were slightly, but not significantly, reduced when compared with non-specific siRNA.
18187541 Members of the ROCK/Rho pathway act upstream from the kinase that phosphorylates P450c17 in a fashion that augments 17,20 lyase activity, possibly acting to catalyze a priming phosphorylation.
18184656 PKA 1) induces metabolic changes in the adrenal cortex and 2) phosphorylates CtBP1 and 2 proteins, particularly CtBP1 at T144, resulting in CtBP protein partnering and ACTH-dependent CYP17 transcription
18172694 Genetic variation in CYP17 is not associated with endometrial cancer
18172694 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18163429 Observational study of gene-disease association. (HuGE Navigator)
18006912 Observational study of gene-disease association. (HuGE Navigator)
18000308 Lower 3beta-hydroxysteroid dehydrogenase type 2 but higher 17,20-lyase activity in NCI-H295R cells explaining the 'androgenic' steroid profile for these cells and resembling the zona reticularis of the human adrenal cortex.
17986287 Observational study of gene-disease association. (HuGE Navigator)
17986287 results are consistent with the conclusions of a previous meta-analysis, and suggest that rs743572 has no role in the risk of prostate cancer for men of Caucasian origin.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17961073 Observational study of gene-disease association. (HuGE Navigator)
17961073 CYP17 gene polymorphism may be associated with benign prostatic hyperplasia in the Turkish population
17895316 decreased levels of c-fos expression in polycystic ovaries may be responsible for increased CYP17 levels in polycystic ovary syndrome
17875358 The association between prenatal alcohol exposure and intrauterine fetal growth restriction was modulated by the maternal CYP17 A1A1 genotype.
17875358 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17826473 Observational study of gene-disease association. (HuGE Navigator)
17826473 results suggest that the CYP17 polymorphism (-34T>C) is associated with overall survival in patients with androgen-independent prostate cancer
17786540 SMAD3 dependent inactivation of CYP17 promoter activity and repression of SF-1 expression.
17785571 Observational study of gene-disease association. (HuGE Navigator)
17765230 Observational study of gene-disease association. (HuGE Navigator)
17760252 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17704407 Observational study of gene-disease association. (HuGE Navigator)
17669147 the A2A2 genotype from CYP17 was associated with a higher stromal ratio without being associated with increased prostate weight
17664281 Data show that cyclic AMP-stimulated interaction between steroidogenic factor 1 and diacylglycerol kinase theta facilitates induction of CYP17.
17615053 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17606708 Observational study of gene-disease association. (HuGE Navigator)
17606708 Cytochrome P450 17A1 and catechol O-methyltransferase polymorphisms have roles in development of Lynch syndrome colon cancer
17589376 Observational study of gene-disease association. (HuGE Navigator)
17588204 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17507624 Observational study of gene-disease association. (HuGE Navigator)
17484509 Observational study of gene-disease association. (HuGE Navigator)
17484509 differences in the CYP17 polymorphism (-34T-->C) frequencies between endometriosis cases and controls were not even close to significance (p = 0.278)
17386955 first report showing the heterologous expression of this fully functional human steroidogenic cytochrome P450 enzyme in Pichia pastoris.
17359589 Observational study of gene-disease association. (HuGE Navigator)
17359589 No statistically significant association exists between the CYP17 and CYP19 trinucleotide deletion polymorphisms and the risk of idiopathic recurrent miscarriages among women from South India
17328668 Observational study of gene-disease association. (HuGE Navigator)
17307805 Observational study of gene-disease association. (HuGE Navigator)
17307805 short menstrual cycles were more common with increasing number of variant A2 alleles; each A2 allele was associated with a 7 months earlier oral contraceptive start; homozygosity for A2 allele more common among known non-carriers from BRCA1/2 families
17235448 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17235448 CYP17 gene polymorphism is associated with breast cancer
17218734 Observational study of gene-disease association. (HuGE Navigator)
17167982 Observational study of gene-disease association. (HuGE Navigator)
17119038 Observational study of gene-disease association. (HuGE Navigator)
17119038 CYP17A1 and CYP17A2 have roles in regulating levels of salivary 17-beta estradiol
17110639 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
17108148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17077994 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17077994 SHBG, but not CYP17, CYP1B1, or COMT polymorphisms are associated with different sex hormone levels in post-menopausal breast cancer survivors
16977255 Observational study of gene-disease association. (HuGE Navigator)
16971197 Observational study of gene-disease association. (HuGE Navigator)
16969494 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16909599 Observational study of gene-disease association. (HuGE Navigator)
16896040 Observational study of gene-disease association. (HuGE Navigator)
16890174 Observational study of gene-disease association. (HuGE Navigator)
16887917 Sphingosine is a bonafide endogenous ligand for SF1 and a negative regulator of CYP17 gene expression.
16885156 FOXO1 and SREBP-1c have roles in insulin regulation of cholesterol 7alpha-hydroxylase expression
16875543 Observational study of gene-disease association. (HuGE Navigator)
16859836 Observational study of gene-disease association. (HuGE Navigator)
16850246 Observational study of gene-disease association. (HuGE Navigator)
16783967 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16782804 Observational study of gene-disease association. (HuGE Navigator)
16739881 Observational study of gene-disease association. (HuGE Navigator)
16730930 Observational study of genotype prevalence. (HuGE Navigator)
16720291 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16716118 Observational study of gene-disease association. (HuGE Navigator)
16707883 Observational study of gene-disease association. (HuGE Navigator)
16702327 Observational study of gene-disease association. (HuGE Navigator)
16638864 Observational study of gene-disease association. (HuGE Navigator)
16616104 Adding an epitope tag to the C-terminus of the P450c17 protein does not interfere with its activities and will be a useful tool to isolate human P450c17 protein from cultured cells.
16608396 Observational study of gene-disease association. (HuGE Navigator)
16604478 Nine alleles have the mutation of 6436-6438(TAC-->AA), accounting for 90% of total alleles (9/10); this kind of mutation may have racial specificity
16603433 Observational study of gene-disease association. (HuGE Navigator)
16595705 effect of substrate on the redox potential for each P450c17 was measured in the presence of pregnenolone, progesterone, 17alpha-hydroxypregnenolone and 17alpha-hydroxyprogesterone
16595228 Observational study of gene-disease association. (HuGE Navigator)
16595228 Carriage of the ESR1 IVS1-397 T/C (PvuII), COMT G158A, and the CYP17A 34T-->C SNPs is not associated with the susceptibility to uterine leiomyoma in a Caucasian population.
16527884 Observational study of gene-disease association. (HuGE Navigator)
16527884 COMT, but not CYP1A1 or CYP17, appears to have roles in adenomyosis and endometriosis
16519145 Observational study of gene-disease association. (HuGE Navigator)
16519145 More frequency of A2/A2 genotype in prostate cancer than in the control may be associated with the morbidity of prostate cancer in Chinese Vigurs male population.
16515644 Observational study of gene-disease association. (HuGE Navigator)
16515644 CYP17 polymorphism had correlation with endometrial atypia and cancer but not to endometrial cell proliferation rate
16424004 Observational study of gene-disease association. (HuGE Navigator)
16411751 a specific allosteric binding site on Cytochrome b5, which includes residues E48, E49, and possibly R52, mediates the stimulation of 17,20-lyase activity of Cytochrome P450c17
16385451 Observational study of gene-disease association. (HuGE Navigator)
16381022 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16354159 CYP expression and induction profiles and the morphological features of WIF-B9 cells allow prediction in vitro of the induction and hepatotoxicity profiles of chemical entities.
16319265 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16306078 there is a role for sphingolipid metabolism and SREBP1 in ACTH-dependent CYP17 regulation and steroidogenesis
16280037 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16260521 Observational study of gene-disease association. (HuGE Navigator)
16244490 Meta-analysis of gene-disease association. (HuGE Navigator)
16232327 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16214922 Observational study of gene-disease association. (HuGE Navigator)
16202920 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16045239 Observational study of gene-disease association. (HuGE Navigator)
16045239 in Caucasian subjects neither the T/C CYP17 gene polymorphism nor the tetranucleotide repeat (TTTA) polymorphism of the CYP19 gene contributes to the genetic susceptibility to CAD
15999490 Observational study of gene-disease association. (HuGE Navigator)
15987458 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15987450 Observational study of gene-disease association. (HuGE Navigator)
15953542 Observational study of gene-disease association. (HuGE Navigator)
15953542 Results suggest that CYP17A1 -34T --> C polymorphism was associated with bone mineral density (BMD) in postmenopausal women, with the CC genotype being related to increased BMD.
15941966 Observational study of gene-disease association. (HuGE Navigator)
15927351 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15916684 Observational study of gene-disease association. (HuGE Navigator)
15886251 resistin enhanced 17alpha-hydroxylase activity in the presence of forskolin or a combination of forskolin plus insulin in theca cells
15878919 Observational study of gene-disease association. (HuGE Navigator)
15865082 Observational study of gene-disease association. (HuGE Navigator)
15824149 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15823822 Observational study of gene-disease association. (HuGE Navigator)
15799583 Observational study of gene-disease association. (HuGE Navigator)
15774541 Observational study of gene-disease association. (HuGE Navigator)
15761247 Observational study of gene-disease association. (HuGE Navigator)
15761247 Genetic polymorphism in 5'-untranslated region of CYP17 is associated with breast cancer development
15749482 Observational study of gene-disease association. (HuGE Navigator)
15749482 ER alpha* 14 TA repeats and the CYP17* A1 allele are associated with an increased risk of endometriosis
15711606 Observational study of gene-disease association. (HuGE Navigator)
15706422 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15687493 Data suggest that cytochrome b5 and phosphorylation enhance 17,20 lyase activity independently of each other, probably by increasing the interaction between P450c17 and NADPH-cytochrome P450 oxidoreductase.
15686129 Observational study of gene-disease association. (HuGE Navigator)
15663233 Observational study of gene-disease association. (HuGE Navigator)
15654505 Observational study of gene-disease association. (HuGE Navigator)
15609124 Observational study of gene-disease association. (HuGE Navigator)
15609124 The CYP17 A2 allele is associated with hormone levels, and interacts with insulin levels and diet to affect breast density levels and potentially breast cancer risk.
15604994 Observational study of gene-disease association. (HuGE Navigator)
15598676 a slower rate of CYP17 mRNA decay contributes to increased steady-state mRNA accumulation and augmented CYP17 gene expression in polycystic ovary theca cells.
15591802 Observational study of gene-disease association. (HuGE Navigator)
15555906 Arg(347), Arg(358) and Arg(449) are important for activity, cytochrome b(5) promotes conformational changes
15539439 Observational study of gene-disease association. (HuGE Navigator)
15539439 No evidence was found for a relationship between common variants of the ERalpha gene and the CYP17 gene with age at natural menopause.
15538743 Observational study of gene-disease association. (HuGE Navigator)
15536258 Observational study of gene-disease association. (HuGE Navigator)
15482786 Observational study of gene-disease association. (HuGE Navigator)
15477877 Observational study of gene-disease association. (HuGE Navigator)
15477877 Polymorphisms of CYP17 is associated with prostate cancer risk
15466495 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, and genetic testing. (HuGE Navigator)
15382051 Observational study of gene-disease association. (HuGE Navigator)
15372520 Observational study of gene-disease association. (HuGE Navigator)
15364798 In contrast to other studies, this study demonstrated in situ expression of CYP17 mRNA and protein in heart tissue.
15341023 Observational study of gene-disease association. (HuGE Navigator)
15241822 Observational study of gene-disease association. (HuGE Navigator)
15241822 CYP1A1-1 (P = 0.004) and CYP1A1-2 (P = 0.03) were found to be associated with significantly decreased and increased risks of breast carcinoma, respectively.
15235815 Observational study of gene-disease association. (HuGE Navigator)
15199113 Observational study of gene-disease association. (HuGE Navigator)
15195127 Observational study of gene-disease association. (HuGE Navigator)
15129369 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15129369 In conclusion, the A2 allele of the CYP17 T(27)-C polymorphism is associated with reduced bone mass and bone size in lean perimenopausal women, whereas high BMI protects against this negative association.
15072828 Observational study of gene-disease association. (HuGE Navigator)
15072828 CYP17 genetic polymorphism is associated with endometrial cancer
14995917 Observational study of gene-disease association. (HuGE Navigator)
14995917 African women, homozygous carriers of the CYP17 A2 allele expose their myometrium to a stronger estrogenic stimulation, predisposing to the pathophysiology of uterine leiomyomas.
14985252 Colocalization of CytB5 and P450c17 strongly supports the view that CytB5 plays an important role in the regulation of the androgen biosynthetic pathway in the fetal and adult human.
14744739 Observational study of gene-disease association. (HuGE Navigator)
14715870 Observational study of gene-disease association. (HuGE Navigator)
14715870 both cytochrome P450, family 17 and cytochrome P450, family 19 are candidate genes for osteoporosis in postmenopausal women
14714492 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14693733 Observational study of gene-disease association. (HuGE Navigator)
14684846 diminished NF-1C-dependent repression may be one mechanism underlying increased basal CYP17 promoter activity and altered gene expression in PCOS (polycystic ovary syndrome) theca cells.
14665706 Observational study of gene-disease association. (HuGE Navigator)
14644808 CYP17 promoter is more active in polycystic ovary syndrome theca cells than in normal theca cells.
14634838 Observational study of genotype prevalence. (HuGE Navigator)
14575568 Observational study of gene-disease association. (HuGE Navigator)
14561815 Observational study of gene-disease association. (HuGE Navigator)
14552333 Deficiency in this enzyme is due to missense/nonsense mutation and amino acid subsitution.
14552332 Deficiency in this enzyme is due to missense-nonsense mutations, and amino acid substitution.
14512432 insulin stimulates PI3-kinase and extracellular signal-regulated kinase-1/2 activities in human theca cells, but only PI3-kinase mediates the insulin augmentation of forskolin-stimulated 17alpha-hydroxylase activity.
14504283 role of E305G mutation in causing 17,20-lyase deficiency
12971967 Observational study of gene-disease association. (HuGE Navigator)
12971967 CYP17 high-activity alleles associated with increased circulating levels of estrogens and androgens may affect liver cancer risk in HCV-infected women.
12954495 Observational study of gene-disease association. (HuGE Navigator)
12949806 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12719950 Observational study of gene-disease association. (HuGE Navigator)
12718576 Observational study of genotype prevalence. (HuGE Navigator)
12692107 Observational study of gene-disease association. (HuGE Navigator)
12692107 High-activity CYP17 alleles, involved in estrogen formation, were not associated with pubertal stage.
12652520 Observational study of gene-disease association. (HuGE Navigator)
12645864 description of familial occurrence of combined partial 17,20-desmolase and 17alpha-hydroxylase deficiency in phenotypically normal normotensive women who presented with primary infertility, anovulation and persistent cervical dysmucorrhea
12644832 Observational study of gene-disease association. (HuGE Navigator)
12631398 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12631293 Results demonstrate that human P450c17 is involved in the biosynthetic pathway leading to the formation of androstenol.
12602902 Observational study of gene-disease association. (HuGE Navigator)
12584742 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12582021 Meta-analysis of gene-disease association. (HuGE Navigator)
12574216 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12574216 the estrogen-metabolizing CYP17 genotype influences age at menarche in healthy postmenopausal Japanese women.
12530676 CYP17 expressed centrally within fetal zone at 50 days post-conception and later during first trimester.
12530662 A dual-specificity phosphatase, possibly MKP-1, is essential for enhancing hCYP17 transcription in adrenal cortex by desphosphorylating of SF-1, thereby increasing the binding affinity of SF-1, p54nrb, and PSF for hCYP17 promoter.
12530647 Neutralization of positive charges in the redox partner binding surface of CYP17 may be the predominant if not sole mechanism leading to isolated 17,20-lyase deficiency
12530262 Observational study of gene-disease association. (HuGE Navigator)
12517592 cytochrome P450 17alpha-hydroxylase mRNA was detected in the ovarian stroma of all women with endometrial cancer
12506119 enhancement of transcription by cAMP-dependent protein kinase via MKP-1 activation in human adrenocortical cells
12466376 Differential inhibition of 17alpha-hydroxylase and 17,20-lyase activities by three novel missense CYP17 mutations identified in patients with P450c17 deficiency.
12464252 CYP17 binding sites for progesterone enantiomers are analyzed
12444089 Protein phosphatase 2A and phosphoprotein SET regulate androgen production by this enzyme.
12385014 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12370109 Observational study of gene-disease association. (HuGE Navigator)
12368392 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12164325 Observational study of genotype prevalence. (HuGE Navigator)
12036914 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12036913 Observational study of gene-disease association. (HuGE Navigator)
11956159 activation of protein phosphatase(s) is essential for cAMP-dependent transcription of human CYP17
11925378 Association of the CYP17 gene polymorphism with risk of endometriosis in Japanese women. not significantly different between the groups. An increased frequency of the D/D genotype.
11911969 Observational study of gene-disease association. (HuGE Navigator)
11911969 CYP17 genetic polymorphism in endometrial cancer
11897684 the hCYP17 promoter showed the formation of three DNA-protein complexes: steroidogenic factor (SF-1) and p54(nrb)/NonO, p54(nrb)/NonO and polypyrimidine tract-binding protein-associated splicing factor (PSF) and SF-1/PSF/p54(nrb)/NonO complex
11895872 Observational study of gene-disease association. (HuGE Navigator)
11888844 decrease in DHEA and DHEA-S concentrations together with the high F levels that occur in patients with type 2 diabetes mellitus is associated with high 17-hydroxylase
11880540 Meta-analysis of gene-disease association. (HuGE Navigator)
11867265 results support the idea that types 1 and 2 cyt-b5 could be involved in the differential modulation of 17 alpha-hydroxylase and 17,20-lyase activities of P450c17
11847524 Observational study of genotype prevalence. (HuGE Navigator)
11839369 Observational study of gene-gene interaction. (HuGE Navigator)
11834432 study provides the first description of 17alpha-hydroxylase activity in adipose tissue and the detection of a new form of the P450c17 cDNA containing a 156 bp in-frame deletion in the first exon
11749050 Observational study of gene-disease association. (HuGE Navigator)
11749050 Investigators examining possible associations between early menarche and mutations in genes of estrogen metabolism found no such association for this gene.
11668516 Observational study of gene-disease association. (HuGE Navigator)
11571725 Observational study of gene-disease association. (HuGE Navigator)
11535545 Observational study of gene-disease association. (HuGE Navigator)
11470993 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11440959 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11379008 Observational study of gene-disease association. (HuGE Navigator)
11358812 Observational study of gene-disease association. (HuGE Navigator)
11341336 Observational study of gene-disease association. (HuGE Navigator)
11303586 Observational study of gene-disease association. (HuGE Navigator)
11248649 Observational study of gene-disease association. (HuGE Navigator)
11232039 Observational study of gene-disease association. (HuGE Navigator)
11221867 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11212283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11142420 Observational study of gene-disease association. (HuGE Navigator)
11094312 Observational study of gene-disease association. (HuGE Navigator)
11059764 Observational study of gene-disease association. (HuGE Navigator)
11036113 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGT      1 - 70
KTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQ     71 - 140
KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLS    141 - 210
KDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGP    211 - 280
DQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRL    281 - 350
LLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP    351 - 420
AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFK    421 - 490
VKIKVRQAWREAQAEGST                                                        491 - 508
//

Text Mined References (488)

PMID Year Title
26973185 [Interaction of novel oxazoline derivatives of 17(20)e-pregna-5,17(20)-diene with cytochrome P450 17A1].
26940238 2016 Association between CYP17A1 rs3824755 and rs743572 gene polymorphisms and Alzheimer's disease in the Chinese Han population.
26902494 2016 Common Polymorphisms at the CYP17A1 Locus Associate With Steroid Phenotype: Support for Blood Pressure Genome-Wide Association Study Signals at This Locus.
26719338 2016 Cytochrome P450 17A1 Interactions with the FMN Domain of Its Reductase as Characterized by NMR.
26668369 2015 Unveiling the crucial intermediates in androgen production.
26634548 2015 Polymorphisms in CYP17, COMT, and ESR1 genes in women after menopause and association with bone mineral density.
26587646 2015 Mechanistic Scrutiny Identifies a Kinetic Role for Cytochrome b5 Regulation of Human Cytochrome P450c17 (CYP17A1, P450 17A1).
26414697 2016 Polymorphisms in genes in the androgen pathway and risk of Barrett's esophagus and esophageal adenocarcinoma.
26407154 2015 Evaluation of CYP17A1 and LEP Gene Polymorphisms in Breast Cancer.
26345865 2015 New compound heterozygous mutations of p. Thr101Ilefs 2 and p. Thr306Ale in a child from a Chinese family with 17?-hydroxylase/17, 20-lyase deficiency.
26263970 2015 A Single Nucleotide Polymorphism near the CYP17A1 Gene Is Associated with Left Ventricular Mass in Hypertensive Patients under Pharmacotherapy.
26225710 2015 Association of Cytochrome-17 (MspA1) Gene Polymorphism with Risk of Gall Bladder Stones and Cancer in North India.
26025587 2015 Structural features and dynamic investigations of the membrane-bound cytochrome P450 17A1.
26002733 2015 Acyl-Carbon Bond Cleaving Cytochrome P450 Enzymes: CYP17A1, CYP19A1 and CYP51A1.
25990650 2015 The relationship between the polymorphisms of the CYP17A1 gene and hypertension: A meta-analysis.
25929975 2015 The CYP17?MspA1 Polymorphism and the Gender Dysphoria.
25917616 2015 CYP17A1 and CYP2E1 variants associated with high altitude polycythemia in Tibetans at the Qinghai-Tibetan Plateau.
25897673 2015 Circulating cell-free AR and CYP17A1 copy number variations may associate with outcome of metastatic castration-resistant prostate cancer patients treated with abiraterone.
25889125 2015 Relationship between CYP17A1 genetic polymorphism and coronary artery disease in a Chinese Han population.
25765894 2015 Identification of a novel large CYP17A1 deletion by MLPA analysis in a family with classic 17?-hydroxylase deficiency.
25719302 2015 17?-Hydroylase/17,20-lyase deficiency related to P.Y27*(c.81C>A) mutation in CYP17A1 gene.
25697092 2015 New, recurrent, and prevalent mutations: Clinical and molecular characterization of 26 Chinese patients with 17alpha-hydroxylase/17,20-lyase deficiency.
25650406 2015 Partial deficiency of 17?-hydroxylase/17,20-lyase caused by a novel missense mutation in the canonical cytochrome heme-interacting motif.
25592814 2015 Haplotype analyses of CYP17A1 genetic polymorphisms and coronary artery disease in a Uygur population.
25514466 2015 The DHEA-sulfate depot following P450c17 inhibition supports the case for AKR1C3 inhibition in high risk localized and advanced castration resistant prostate cancer.
25448501 2015 CYP17 genotype modifies the impact of anthropometric variation on salivary estradiol in healthy women.
25386927 2014 Epoxidation activities of human cytochromes P450c17 and P450c21.
25337833 Association between cytochrome CYP17A1, CYP3A4, and CYP3A43 polymorphisms and prostate cancer risk and aggressiveness in a Korean study population.
25323563 2015 Quantitative assessment of the association between CYP17 rs743572 polymorphism and prostate cancer risk.
25315771 2014 Catalytically relevant electrostatic interactions of cytochrome P450c17 (CYP17A1) and cytochrome b5.
25301938 2014 Structures of human steroidogenic cytochrome P450 17A1 with substrates.
25251696 2014 New CYP17 hydroxylase inhibitors: synthesis, biological evaluation, QSAR, and molecular docking study of new pregnenolone analogs.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25208301 2015 Association of CYP17A1 gene -34T/C polymorphism with polycystic ovary syndrome in Han Chinese population.
25150952 2014 Are CYP1A1, CYP17 and CYP1B1 mutation genes involved on girls with precocious puberty? A pilot study.
25064838 2014 CYP17A1 gene polymorphisms and environmental exposure to organochlorine pesticides contribute to the risk of small for gestational age.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25030786 2014 Risk for estrogen-dependent diseases in relation to phthalate exposure and polymorphisms of CYP17A1 and estrogen receptor genes.
25012481 2014 Association study of two steroid biosynthesis genes (COMT and CYP17) with Alzheimer's disease in the Italian population.
24875910 2014 Association of CYP1A1, CYP1B1 and CYP17 gene polymorphisms and organochlorine pesticides with benign prostatic hyperplasia.
24714196 2014 17?-hydroxylase deficiency diagnosed in early infancy caused by a novel mutation of the CYP17A1 gene.
24687554 2014 CYP17 polymorphism (rs743572) is associated with increased risk of gallbladder cancer in tobacco users.
24681790 Genetic variant in the CYP17 gene and risk of premature coronary artery disease.
24671419 2014 Human cytochrome P450 17A1 conformational selection: modulation by ligand and cytochrome b5.
24629213 2014 Polymorphisms in phase I and phase II genes and breast cancer risk and relations to persistent organic pollutant exposure: a case-control study in Inuit women.
24597476 2014 CYP17A1 gene mutations and hypertension variations found in 46, XY females with combined 17?-hydroxylase/17, 20-lyase deficiency.
24498484 2014 Congenital Adrenal Hyperplasia due to 17-alpha-hydoxylase/17,20-lyase Deficiency Presenting with Hypertension and Pseudohermaphroditism: First Case Report from Oman.
24485502 2014 Fertility in patients with genetic deficiencies of cytochrome P450c17 (CYP17A1): combined 17-hydroxylase/17,20-lyase deficiency and isolated 17,20-lyase deficiency.
24430361 2014 Genetic polymorphisms of ESR1, ESR2, CYP17A1, and CYP19A1 and the risk of breast cancer: a case control study from North India.
24389397 2014 Dehydroepiandrosterone sulphate as a putative protective factor against tardive dyskinesia.
24299954 2014 Active site proton delivery and the lyase activity of human CYP17A1.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24244276 2013 Characterization of prostate cancer bone metastases according to expression levels of steroidogenic enzymes and androgen receptor splice variants.
24160919 2013 Kinetic solvent isotope effect in human P450 CYP17A1-mediated androgen formation: evidence for a reactive peroxoanion intermediate.
24140493 2014 The polymorphism (-600 C>A) of CpG methylation site at the promoter region of CYP17A1 and its association of male infertility and testosterone levels.
24140098 2014 A review of the literature on common CYP17A1 mutations in adults with 17-hydroxylase/17,20-lyase deficiency, a case series of such mutations among Koreans and functional characteristics of a novel mutation.
24014605 2013 Increased protein expression of LHCG receptor and 17?-hydroxylase/17-20-lyase in human polycystic ovaries.
24001895 2013 Genome-wide association study meta-analysis reveals transethnic replication of mean arterial and pulse pressure loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23888338 2013 Lack of association between CYP17 Mspa1 polymorphism and prostate cancer risk: a meta-analysis of 14494 cases and 15971 controls.
23836902 2013 Phosphorylation of human cytochrome P450c17 by p38? selectively increases 17,20 lyase activity and androgen biosynthesis.
23809139 2013 Polymorphic variants of CYP17 and CYP19A and risk of infertility in endometriosis.
23775394 2013 Association between a common CYP17A1 haplotype and anxiety in female anorexia nervosa.
23759979 2014 Association of common variants in/near six genes (ATP2B1, CSK, MTHFR, CYP17A1, STK39 and FGF5) with blood pressure/hypertension risk in Chinese children.
23649771 2013 Genetic variation of the CYP17 and susceptibility to endometrial cancer: a meta-analysis.
23621184 2013 A2 allele polymorphism of the CYP17 gene and prostate cancer risk in an iranian population.
23620596 2013 Substrate-modulated cytochrome P450 17A1 and cytochrome b5 interactions revealed by NMR.
23609033 2013 CYP17A1 T-34C polymorphism is not associated with endometrial cancer risk.
23586722 2013 Role of microsomal steroid hydroxylases in ?7-steroid biosynthesis.
23551929 2013 Evaluation of the fluorescent probes Nile Red and 25-NBD-cholesterol as substrates for steroid-converting oxidoreductases using pure enzymes and microorganisms.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23467202 2013 Common polymorphism rs11191548 near the CYP17A1 gene is associated with hypertension and systolic blood pressure in the Han Chinese population.
23350368 2012 [LOH and genetic polymorphysms of breast cancer].
23291414 2013 Identifying a novel mutation of CYP17A1 gene from five Chinese 17?-hydroxylase/17, 20-lyase deficiency patients.
23257735 2013 Characterization of steroidogenic enzyme expression in aldosterone-producing adenoma: a comparison with various human adrenal tumors.
23229009 2012 CYP17 and CYP19 genetic variants are not associated with age at natural menopause in Polish women.
23133444 2012 Genetic variation in CYP17A1 is associated with arterial stiffness in diabetic subjects.
23129512 2013 Polymorphisms in CYP17 and CYP3A4 and prostate cancer in men of African descent.
23036723 2013 Identification of a novel mutation in CYP17A1 gene.
23015357 2013 Menstrual and reproductive factors in women, genetic variation in CYP17A1, and pancreatic cancer risk in the European prospective investigation into cancer and nutrition (EPIC) cohort.
22959498 2013 Recapitulation of four hypertension susceptibility genes (CSK, CYP17A1, MTHFR, and FGF5) in East Asians.
22954317 2013 CYP17A1 mutations identified in 17 Chinese patients with 17?-hydroxylase/17,20-lyase deficiency.
22951291 2012 The activities of 5?-reductase and 17,20-lyase determine the direction through androgen synthesis pathways in patients with 21-hydroxylase deficiency.
22873692 2012 Minor activities and transition state properties of the human steroid hydroxylases cytochromes P450c17 and P450c21, from reactions observed with deuterium-labeled substrates.
22714708 2013 Genetic polymorphisms of CYP17A1 in steroidogenesis pathway are associated with risk of progression to castration-resistant prostate cancer in Japanese men receiving androgen deprivation therapy.
22653668 2012 A family-based association study identified CYP17 as a candidate gene for obesity susceptibility in Caucasians.
22528335 2012 Effect of CYP17 and PSA gene polymorphisms on prostate cancer risk and circulating PSA levels in the Slovak population.
22456087 2012 MspA1 polymorphism of the CYP17 gene in breast cysts.
22434081 2012 Expression of P450c17 in the human fetal nervous system.
22419734 2012 Genetic polymorphism CYP17 rs2486758 and metabolic risk factors predict daily salivary 17?-estradiol concentration in healthy premenopausal Norwegian women. The EBBA-I study.
22331461 2012 Female reproductive factors, gene polymorphisms in the estrogen metabolism pathway, and risk of lung cancer in Chinese women.
22309630 2012 Primary amenorrhea in two sisters: description of a Mexican family with 17? hydroxylase-17 lyase deficiency caused by arginine - stop mutation.
22266943 2012 Structures of cytochrome P450 17A1 with prostate cancer drugs abiraterone and TOK-001.
22238371 2012 Association study of CYP17 and HSD11B1 in polycystic ovary syndrome utilizing comprehensive gene coverage.
22237020 2012 Polymorphism T?C of gene CYP17 promoter and polycystic ovary syndrome risk: a meta-analysis.
22217842 1992 Molecular basis of 17?-hydroxylase/17,20-lyase deficiency.
22174412 2012 Direct regulation of androgen receptor activity by potent CYP17 inhibitors in prostate cancer cells.
22170710 2012 A missense mutation in the human cytochrome b5 gene causes 46,XY disorder of sex development due to true isolated 17,20 lyase deficiency.
22103881 2012 Clinical and genetic analysis for two Chinese siblings with 17?-hydroxylase/17,20-lyase deficiency.
22072737 2012 The syndrome of 17,20 lyase deficiency.
22071413 2012 Genetic variations in the CYP17A1 and NT5C2 genes are associated with a reduction in visceral and subcutaneous fat areas in Japanese women.
22066265 [Screening of potential substrates or inhibitors of cytochrome P450 17A1 (CYP17A1) by electrochemical methods].
22057025 2012 Variants in CYP17 and CYP19 cytochrome P450 genes are associated with onset of Alzheimer's disease in women with down syndrome.
22048715 2012 A sex-specific effect of the CYP17A1 SNP rs11191548 on blood pressure in Chinese children.
22001566 2012 Synthesis of halogenated pregnanes, mechanistic probes of steroid hydroxylases CYP17A1 and CYP21A2.
21966534 2011 CYP17A1 intron mutation causing cryptic splicing in 17?-hydroxylase deficiency.
21963141 2011 Genetic variations in CYP17A1, CACNB2 and PLEKHA7 are associated with blood pressure and/or hypertension in She ethnic minority of China.
21948762 2011 Association of serum sex steroid levels and bone mineral density with CYP17 and CYP19 gene polymorphisms in postmenopausal women in Turkey.
21919858 2012 Prostate cancer with variants in CYP17 and UGT2B17 genes: a meta-analysis.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21896988 A CYP17A1 gene polymorphism in association with multiple uterine leimyomas; a meta-analysis.
21868758 2011 Intratumoral de novo steroid synthesis activates androgen receptor in castration-resistant prostate cancer and is upregulated by treatment with CYP17A1 inhibitors.
21848792 2011 Increased expression of CYP17 and CYP11B1 in subclinical Cushing's syndrome due to adrenal adenomas.
21676446 2011 Polymorphisms in the P450 c17 (17-hydroxylase/17, 20-Lyase) gene: association with estradiol and testosterone concentration in hypospadias.
21656827 2011 CYP17 gene polymorphisms and prostate cancer risk: a meta-analysis based on 38 independent studies.
21644229 2011 [Association of single nucleotide polymorphism in CYP17 and ER? genes with endometriosis risk in southern Chinese women].
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
21511288 2011 Hypospadias risk and polymorphism in SRD5A2 and CYP17 genes: case-control study among Indian children.
21420394 2011 Prevalence of common mutations in the CYP17A1 gene in Chinese Han population.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21338212 2010 Association of a CYP17 gene polymorphism with development of breast cancer in India.
21307141 2011 The human placenta expresses CYP17 and generates androgens de novo.
21300759 2011 EGFR L858R mutation and polymorphisms of genes related to estrogen biosynthesis and metabolism in never-smoking female lung adenocarcinoma patients.
21193363 2011 CYP17 gene polymorphism and prostate cancer susceptibility in a Tunisian population.
21094112 2011 Genetic polymorphisms of CYP17A1, vitamin D receptor and androgen receptor in Italian heredo-familial and sporadic prostate cancers.
21045733 2011 Discovery and replication of novel blood pressure genetic loci in the Women's Genome Health Study.
20886547 2011 Cytochrome P450 17 (CYP17) is involved in endometrial cancinogenesis through apoptosis and invasion pathways.
20884100 2011 Promoter variant -204A > C of the cholesterol 7?-hydroxylase gene: association with response to plant sterols in humans and increased transcriptional activity in transfected HepG2 cells.
20852445 2011 Common variants in or near FGF5, CYP17A1 and MTHFR genes are associated with blood pressure and hypertension in Chinese Hans.
20798986 2011 The CYP17A1 -34T > C polymorphism and breast cancer risk in BRCA1 and BRCA2 mutation carriers.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20729792 2010 Genetic polymorphism of catechol-O-methyltransferase and cytochrome P450c17? in preeclampsia.
20729390 2010 Serum estrogen and tumor-positive estrogen receptor-alpha are strong prognostic classifiers of non-small-cell lung cancer survival in both men and women.
20728566 2010 Betel quid chewing as an environmental risk factor for breast cancer.
20720262 2010 17?-Hydroxylase (CYP17) expression and subsequent androstenedione production in the human ovary.
20716560 2010 Genetic variation within the hypothalamus-pituitary-ovarian axis in women with recurrent miscarriage.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20650774 2010 [Correlation between CYP17 gene polymorphisms and female post adolescent acne in Han population in Hunan Province].
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628746 2011 Genetic susceptibility to urinary incontinence: implication of polymorphisms of androgen and oestrogen pathways.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619364 2011 At the crossroads of steroid hormone biosynthesis: the role, substrate specificity and evolutionary development of CYP17.
20595043 2010 Molecular modeling on inhibitor complexes and active-site dynamics of cytochrome P450 C17, a target for prostate cancer therapy.
20539301 2011 Expression of CYP19 and CYP17 is associated with leg length, weight, and BMI.
20534731 2010 Impact of differential P450c17 phosphorylation by cAMP stimulation and by starvation conditions on enzyme activities and androgen production in NCI-H295R cells.
20503394 2010 CYP17 polymorphisms and prostate cancer outcomes.
20479155 2010 Blood pressure and hypertension are associated with 7 loci in the Japanese population.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20432167 2010 Dietary isoflavone intake, polymorphisms in the CYP17, CYP19, 17beta-HSD1, and SHBG genes, and risk of breast cancer in case-control studies in Japanese, Japanese Brazilians, and non-Japanese Brazilians.
20414254 2010 Recapitulation of two genomewide association studies on blood pressure and essential hypertension in the Korean population.
20381444 2010 Polymorphisms in genes of the steroid hormone biosynthesis and metabolism pathways and endometrial cancer risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20207836 2010 FOXL2 interacts with steroidogenic factor-1 (SF-1) and represses SF-1-induced CYP17 transcription in granulosa cells.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
20197673 2010 Clinical, genetic and functional characteristics of three novel CYP17A1 mutations causing combined 17alpha-hydroxylase/17,20-lyase deficiency.
20193327 2009 [Relationship between estrogen-biosynthesis gene (CYP17, CYP19, HSD17beta1) polymorphisms and breast cancer].
20184498 2010 Polymorphisms in catechol-O-methyltransferase and cytochrome p450 subfamily 19 genes predispose towards Madurella mycetomatis-induced mycetoma susceptibility.
20173016 2010 Effect of polymorphisms in selected genes involved in pituitary-testicular function on reproductive hormones and phenotype in aging men.
20171624 2010 Solitary and multiple uterine leiomyomas among Caucasian women: two different disorders?
20133979 CYP17 (T-34C) and CYP19 (Trp39Arg) polymorphisms and their cooperative effects on breast cancer susceptibility.
20113968 2010 CYP17 and CYP2C19 gene polymorphisms in patients with endometriosis.
20099974 2010 Serum level of IGFBP3 and IGF1/IGFBP3 molar ratio in addition to PSA and single nucleotide polymorphism in PSA and CYP17 gene may contribute to early diagnostics of prostate cancer.
20086173 2010 Evidence of limited contributions for intratumoral steroidogenesis in prostate cancer.
20072949 2009 The CYP17 and CYP19 gene single nucleotide polymorphism in women with sporadic breast cancer.
20069306 2011 Genetic variation in the CYP17 gene and recurrent spontaneous abortions.
20043997 2010 A single amino acid residue, Ala 105, confers 16alpha-hydroxylase activity to human cytochrome P450 17alpha-hydroxylase/17,20 lyase.
20043206 2010 Factors influencing the association between CYP17 T34C polymorphism and the risk of breast cancer: meta-regression and subgroup analysis.
20033766 2010 Lack of association between CYP17 MspA1 polymorphism and breast cancer risk: a meta-analysis of 22,090 cases and 28,498 controls.
20013047 2010 No association between CYP17 T-34C polymorphism and breast cancer risk: a meta-analysis involving 58,814 subjects.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19954068 2009 [A case-control study of environmental and genetic factors and prostate cancer in Guangdong].
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19863350 2010 Possible risk modification by polymorphisms of estrogen metabolizing genes in familial breast cancer susceptibility in an Indian population.
19850690 2009 Molecular mechanism for repression of 17alpha-hydroxylase expression and androstenedione production in granulosa cells.
19805543 2009 Organization of cytochrome P450 enzymes involved in sex steroid synthesis: PROTEIN-PROTEIN INTERACTIONS IN LIPID MEMBRANES.
19793597 2010 Novel CYP17A1 mutation in a Japanese patient with combined 17alpha-hydroxylase/17,20-lyase deficiency.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19672705 2010 Postmenopausal estrogen monotherapy-associated breast cancer risk is modified by CYP17A1_-34_T>C polymorphism.
19642097 2010 Genetic variation in CYP17A1 and pancreatic cancer in a population-based case-control study in the San Francisco Bay Area, California.
19636199 2009 A novel mutation in the N-terminal region of the CYP17A1 gene in a patient with 17 alpha-hydroxylase/17,20-lyase deficiency.
19627379 2010 Effect modification of endocrine disruptors and testicular germ cell tumour risk by hormone-metabolizing genes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19508587 2010 Identification of steroid biosynthetic defects in genotype-proven heterozygous individuals for 17alpha-hydroxylase/17,20-lyase deficiency.
19505920 2009 Single and multigenic analysis of the association between variants in 12 steroid hormone metabolism genes and risk of prostate cancer.
19469636 CYP17 (T34C), CYP19 (Trp39Arg), and FGFR2 (C906T) polymorphisms and the risk of breast cancer in south Indian women.
19454579 2009 Steroid 17alpha-hydroxylase deficiency: functional characterization of four mutations (A174E, V178D, R440C, L465P) in the CYP17A1 gene.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19443382 2009 CYP17 gene polymorphism and its association in north Indian prostate cancer patients.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19430479 2009 Genome-wide association study of blood pressure and hypertension.
19415745 2009 Genetic polymorphisms of estrogen metabolizing enzyme and breast cancer risk in Thai women.
19387820 2009 Genetic polymorphisms of FSHR, CYP17, CYP1A1, CAPN10, INSR, SERPINE1 genes in adolescent girls with polycystic ovary syndrome.
19379515 2009 CYP17, GSTP1, PON1 and GLO1 gene polymorphisms as risk factors for breast cancer: an Italian case-control study.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19330259 2009 Polymorphism in CYP17, GSTM1 and the progesterone receptor genes and its relationship with mammographic density.
19267349 2009 A novel communication role for CYP17A1 in the progression of castration-resistant prostate cancer.
19174490 2009 Tobacco and estrogen metabolic polymorphisms and risk of non-small cell lung cancer in women.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19127255 2009 Validating genetic risk associations for ovarian cancer through the international Ovarian Cancer Association Consortium.
19064581 2008 Lack of association between the functional polymorphisms in the estrogen-metabolizing genes and risk for hepatocellular carcinoma.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
19015200 2009 Polymorphisms in estrogen- and androgen-metabolizing genes and the risk of gastric cancer.
19013303 2008 Polymorphism T --> C (-34 base pairs) of gene CYP17 promoter in women with polycystic ovary syndrome is associated with increased body weight and insulin resistance: a preliminary study.
18980759 2010 Polymorphisms of estrogen-related genes jointly confer susceptibility to human spermatogenic defect.
18957719 2008 CYP17 MspA1 polymorphism and age at menarche: a meta-analysis.
18930188 2009 CYP17 and CYP19 gene polymorphisms in women affected with endometriosis.
18820009 2008 Possible difference in frequencies of genetic polymorphisms of estrogen receptor alpha, estrogen metabolism and P53 genes between estrogen receptor-positive and -negative breast cancers.
18781485 2008 CYP17 polymorphism and hot flushes in postmenopausal women.
18767927 2009 Genetic variation in sex hormone genes influences heel ultrasound parameters in middle-aged and elderly men: results from the European Male Aging Study (EMAS).
18725155 2009 CYP11A1 and CYP17 promoter polymorphisms associate with hyperandrogenemia in polycystic ovary syndrome.
18722876 2008 Role of hormonal genes and risk of prostate cancer: gene-gene interactions in a North Indian population.
18707589 2008 Engineering, expression, and purification of "soluble" human cytochrome P45017alpha and its functional characterization.
18682255 2009 Arsenic metabolism is influenced by polymorphisms in genes involved in one-carbon metabolism and reduction reactions.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18645709 2008 Association of the CYP17 gene polymorphism with risk for uterine leiomyoma in Brazilian women.
18636181 2008 Association study for single nucleotide polymorphisms in the CYP17A1 gene and polycystic ovary syndrome.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18629629 2009 Association of genetic polymorphisms of ER-alpha and the estradiol-synthesizing enzyme genes CYP17 and CYP19 with breast cancer risk in Chinese women.
18619494 2008 Association study of the cytochrome P450 17 gene polymorphism with personality traits in healthy subjects.
18618215 2008 Genetic polymorphisms in oestrogen metabolic pathway and breast cancer: a positive association with combined CYP/GST genotypes.
18601603 2008 Polymorphisms of CYP17A1, CYP19, and androgen in Brazilian women with uterine leiomyomas.
18593984 2008 Increased prevalence of EGFR-mutant lung cancer in women and in East Asian populations: analysis of estrogen-related polymorphisms.
18560445 2008 Comprehensive association analyses of IGF1, ESR2, and CYP17 genes with adult height in Caucasians.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18505908 2008 Analysis of mRNA expression for steroidogenic enzymes in the remaining adrenal cortices attached to adrenocortical adenomas.
18503826 2008 A multigenic approach to evaluating prostate cancer risk in a systematic replication study.
18501301 2008 [Genetic determinants of anatomical variants of the prostate].
18499961 2008 [Polymorphism in CYP11alpha and CYP17 genes and the etiology of hyperandrogenism in patients with polycystic ovary syndrome].
18496127 2008 Genetic aspects of epitestosterone formation and androgen disposition: influence of polymorphisms in CYP17 and UGT2B enzymes.
18495332 2008 Shorter CAG repeats in androgen receptor and non-GG genotypes in prostate-specific antigen loci are associated with decreased risk of benign prostatic hyperplasia and prostate cancer.
18491956 2008 PSA and androgen-related gene (AR, CYP17, and CYP19) polymorphisms and the risk of adenocarcinoma at prostate biopsy.
18483327 2008 Polymorphisms in steroid hormone biosynthesis genes and risk of breast cancer and fibrocystic breast conditions in Chinese women.
18437511 2008 Variants in hormone biosynthesis genes and risk of endometrial cancer.
18422032 2008 Novel mutation in cytochrome P450c17 causes complete combined 17alpha-hydroxylase/17,20-lyase deficiency.
18415690 2008 Genetic variation in hormone metabolizing genes and risk of testicular germ cell tumors.
18411914 2007 [Polymorhism of CYP17 gene and age of menarche].
18318428 2008 CYP1A1, SULT1A1, and SULT1E1 polymorphisms are risk factors for endometrial cancer susceptibility.
18305346 2007 Association study of the oestrogen signalling pathway genes in relation to age at natural menopause.
18299473 2008 Metabolic evidence for impaired 17alpha-hydroxylase activity in a kindred bearing the E305G mutation for isolate 17,20-lyase activity.
18281250 2008 Estrogen-biosynthesis gene CYP17 and its interactions with reproductive, hormonal and lifestyle factors in breast cancer risk: results from the Long Island Breast Cancer Study Project.
18262808 2008 Effect of small interfering RNAs of cytochrome P450 17alpha-hydroxylase/17,20-lyase (CYP17) on androgen biosynthesis in theca cells.
18187541 2008 Pathways leading to phosphorylation of p450c17 and to the posttranslational regulation of androgen biosynthesis.
18184656 2008 Phosphorylation of CtBP1 by cAMP-dependent protein kinase modulates induction of CYP17 by stimulating partnering of CtBP1 and 2.
18172694 2008 Genetic variation in CYP17 and endometrial cancer risk.
18163429 2008 Genetic polymorphisms in CYP17, CYP3A4, CYP19A1, SRD5A2, IGF-1, and IGFBP-3 and prostate cancer risk in African-American men: the Flint Men's Health Study.
18006912 2007 CYP17 genetic variation and risk of breast and prostate cancer from the National Cancer Institute Breast and Prostate Cancer Cohort Consortium (BPC3).
18000308 2007 Human adrenal corticocarcinoma NCI-H295R cells produce more androgens than NCI-H295A cells and differ in 3beta-hydroxysteroid dehydrogenase type 2 and 17,20 lyase activities.
17986287 2008 The rs743572 common variant in the promoter of CYP17A1 is not associated with prostate cancer risk or circulating hormonal levels.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17961073 2007 Prostate-specific antigen and 17-hydroxylase polymorphic genotypes in patients with prostate cancer and benign prostatic hyperplasia.
17895316 2007 The mechanism for protein kinase C inhibition of androgen production and 17alpha-hydroxylase expression in a theca cell tumor model.
17875358 2008 Prenatal alcohol exposure, CYP17 gene polymorphisms and fetal growth restriction.
17826473 2007 Association of a CYP17 polymorphism with overall survival in Caucasian patients with androgen-independent prostate cancer.
17786540 2008 SMAD3 inhibits SF-1-dependent activation of the CYP17 promoter in H295R cells.
17785571 2007 Inherited variation in hormone-regulating genes and prostate cancer survival.
17765230 2008 A polymorphism of the CYP17 gene related to sex steroid metabolism is associated with female-to-male but not male-to-female transsexualism.
17760252 2007 [A case-control study on genetic polymorphism of CYP17 MspA(1)I and its association with endometrial cancer risk].
17704407 2007 Combination of polymorphisms from genes related to estrogen metabolism and risk of prostate cancers: the hidden face of estrogens.
17669147 2007 Genetic impact on prostate anatomical variability during ageing: role of CYP17, SRD5A2 and androgen receptor genes polymorphisms.
17664281 2007 Cyclic AMP-stimulated interaction between steroidogenic factor 1 and diacylglycerol kinase theta facilitates induction of CYP17.
17615053 2007 Polymorphisms in the cytochrome P450 genes CYP1A2, CYP1B1, CYP3A4, CYP3A5, CYP11A1, CYP17A1, CYP19A1 and colorectal cancer risk.
17606708 2007 Cytochrome P450 17A1 and catechol O-methyltransferase polymorphisms and age at Lynch syndrome colon cancer onset in Newfoundland.
17589376 Association of estrogen-related polymorphisms with age at menarche, age at final menstrual period, and stages of the menopausal transition.
17588204 2008 Breast cancer: a candidate gene approach across the estrogen metabolic pathway.
17507624 2007 Evaluation of genetic variations in the androgen and estrogen metabolic pathways as risk factors for sporadic and familial prostate cancer.
17484509 2007 Genetic polymorphisms of cytochrome P450cl7alpha (CYP17) and progesterone receptor genes (PROGINS) in the assessment of endometriosis risk.
17386955 2007 Functional expression and characterisation of human cytochrome P45017alpha in Pichia pastoris.
17359589 2007 Role of CYP17 and CYP19 polymorphisms in idiopathic recurrent miscarriages among South Indian women.
17328668 2007 The association of 5alpha-reductase II (SRD5A2) and 17 hydroxylase (CYP17) gene polymorphisms with prostate cancer patients in the Turkish population.
17307805 2007 CYP17 genotype is associated with short menstrual cycles, early oral contraceptive use and BRCA mutation status in young healthy women.
17235448 2007 CYP17 gene polymorphism and its association with high-risk north Indian breast cancer patients.
17218734 2007 Adiposity, estradiol, and genetic variants of steroid-metabolizing enzymes as determinants of bone mineral density.
17167982 2006 The T/C polymorphism of the CYP17 gene and G/A polymorphism of the CYP19 gene in endometrial cancer.
17119038 2006 CYP17 genotypes differ in salivary 17-beta estradiol levels: a study based on hormonal profiles from entire menstrual cycles.
17110639 2007 Variants in estrogen biosynthesis genes, sex steroid hormone levels, and endometrial cancer: a HuGE review.
17108148 2006 Germ-line genetic variation in the key androgen-regulating genes androgen receptor, cytochrome P450, and steroid-5-alpha-reductase type 2 is important for prostate cancer development.
17077994 2007 Associations between the CYP17, CYPIB1, COMT and SHBG polymorphisms and serum sex hormones in post-menopausal breast cancer survivors.
16977255 Polymorphisms in the estrogen synthesis and metabolism pathways and symptoms during the menopausal transition: observations from the Seattle Midlife Women's Health Study.
16971197 2007 CYP17 and COMT gene polymorphisms can influence bone directly, or indirectly through their effects on endogenous sex steroids, in postmenopausal Japanese women.
16969494 2006 Breast cancer risk and polymorphisms in genes involved in metabolism of estrogens (CYP17, HSD17beta1, COMT and MnSOD): possible protective role of MnSOD gene polymorphism Val/Ala and Ala/Ala in women that never breast fed.
16909599 2006 [Association between polymorphisms of CYP17 and CYP3A4 genes and intrahepatic cholestasis of pregnancy in Chengdu].
16896040 2006 Associations among mammographic density, circulating sex hormones, and polymorphisms in sex hormone metabolism genes in postmenopausal women.
16890174 2005 CYP17 polymorphism and tamoxifen-induced hepatic steatosis.
16887917 2006 Sphingosine regulates the transcription of CYP17 by binding to steroidogenic factor-1.
16885156 2006 Insulin regulation of cholesterol 7alpha-hydroxylase expression in human hepatocytes: roles of forkhead box O1 and sterol regulatory element-binding protein 1c.
16875543 2006 [Study on the relationship between polymorphisms of genes (CYP17, CYP19 and SULT1A1) and susceptibility to breast cancer in Chinese women].
16859836 2006 Association of the polymorphisms of genes involved in androgen metabolism and signaling pathways with familial prostate cancer risk in a Japanese population.
16850246 2007 Variants in estrogen metabolism and biosynthesis genes and urinary estrogen metabolites in women with a family history of breast cancer.
16783967 2006 Are CYP17 genotypes a biomarker for ovarian cancer in patients with cancer history in their family?
16782804 2006 Polymorphisms of estrogen-biosynthesis genes CYP17 and CYP19 may influence age at menarche: a genetic association study in Caucasian females.
16739881 2006 The polymorphisms of the CYP17 and CYP19 genes in endometrial cancer patients.
16730930 2006 Hormonal imbalance in two types of endometrial cancer and genetic polymorphism of steroidogenic enzymes.
16720291 2006 Polymorphisms of metabolic enzyme genes, living habits and prostate cancer susceptibility.
16716118 2006 CYP17, SRD5A2, CYP1B1, and CYP2D6 gene polymorphisms with prostate cancer risk in North Indian population.
16707883 2006 The relationship between CYP17 -34T/C polymorphism and acne in Chinese subjects revealed by sequencing.
16702327 2006 CYP17 genotype modifies the association between lignan supply and premenopausal breast cancer risk in humans.
16638864 2006 Association of DNA repair and steroid metabolism gene polymorphisms with clinical late toxicity in patients treated with conformal radiotherapy for prostate cancer.
16616104 2006 Mutagenesis of putative serine-threonine phosphorylation sites proximal to Arg255 of human cytochrome P450c17 does not selectively promote its 17,20-lyase activity.
16608396 2006 Multilocus genotypes spanning estrogen metabolism associated with breast cancer and fibroadenoma.
16604478 2006 Study on the genetic mutations of 17 alpha-hydroxylase/17,20-lyase deficiency in Chinese patients.
16603433 2006 The CYP17 MspA1 polymorphism is not associated with an increased risk of uterine leiomyomas in a Japanese population.
16595705 2006 Direct electrochemistry of human, bovine and porcine cytochrome P450c17.
16595228 2006 Genotype distribution of estrogen receptor-alpha, catechol-O-methyltransferase, and cytochrome P450 17 gene polymorphisms in Caucasian women with uterine leiomyomas.
16527884 2006 CYP17, CYP1A1 and COMT polymorphisms and the risk of adenomyosis and endometriosis in Taiwanese women.
16519145 2006 [Association between the polymorphism of CYP17 gene and risk of prostate cancer in chinese vigurs men].
16515644 CYP17 genetic polymorphism in patients with endometrial hyperplasia and cancer.
16424004 2006 Profiling genetic variation along the androgen biosynthesis and metabolism pathways implicates several single nucleotide polymorphisms and their combinations as prostate cancer risk factors.
16411751 2006 Human cytochrome b5 requires residues E48 and E49 to stimulate the 17,20-lyase activity of cytochrome P450c17.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381022 2006 CYP17 MspA1 polymorphism and risk of biliary tract cancers and gallstones: a population-based study in Shanghai, China.
16354159 2006 Cytochrome P450 expression-induction profile and chemically mediated alterations of the WIF-B9 cell line.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16319265 2005 Cytochrome gene polymorphisms, serum estrogens, and hot flushes in midlife women.
16306078 2006 Cyclic adenosine 5'-monophosphate-dependent sphingosine-1-phosphate biosynthesis induces human CYP17 gene transcription by activating cleavage of sterol regulatory element binding protein 1.
16280037 2005 CYP17 gene polymorphism in relation to breast cancer risk: a case-control study.
16260521 2005 Ten estrogen-related polymorphisms and endometriosis: a study of multiple gene-gene interactions.
16244490 2006 Association of endometriosis risk and genetic polymorphisms involving sex steroid biosynthesis and their receptors: a meta-analysis.
16232327 2005 Polymorphisms of estrogen-metabolizing genes and breast cancer risk: a multigenic study.
16214922 2005 Polymorphisms and haplotypes in the cytochrome P450 17A1, prolactin, and catechol-O-methyltransferase genes and non-Hodgkin lymphoma risk.
16202920 2005 Ten polymorphisms of estrogen-metabolizing genes and a family history of colon cancer--an association study of multiple gene-gene interactions.
16045239 2005 Are the T/C polymorphism of the CYP17 gene and the tetranucleotide repeat (TTTA) polymorphism of the CYP19 gene genetic markers for premature coronary artery disease in Caucasians?
15999490 2005 [Association between polymorphism of CYP17 gene and serum hormone concentrations in aged men].
15987458 2005 CYP17 genetic polymorphism, breast cancer, and breast cancer risk factors: Australian Breast Cancer Family Study.
15987450 2005 CYP17 5'-UTR MspA1 polymorphism and the risk of premenopausal breast cancer in a German population-based case-control study.
15953542 2005 Association of polymorphisms in CYP17A1, MTP, and VLDLR with bone mineral density in community-dwelling Japanese women and men.
15941966 2005 Association of genetic polymorphisms with serum estrogens measured multiple times during a 2-year period in premenopausal women.
15927351 2005 Tumor necrosis factor alpha, CYP 17, urokinase, and interleukin 10 gene polymorphisms in postmenopausal women: correlation to bone mineral density and susceptibility to osteoporosis.
15916684 2005 Polymorphisms in cytochrome P450 17A1 and risk of non-Hodgkin lymphoma.
15886251 2005 Resistin stimulation of 17alpha-hydroxylase activity in ovarian theca cells in vitro: relevance to polycystic ovary syndrome.
15878919 2005 CYP17 genotype predicts serum hormone levels among pre-menopausal women.
15865082 Role of a CYP17 promoter polymorphism for familial prostate cancer risk in Germany.
15824149 2005 Cyp17, urinary sex steroid levels and breast cancer risk in postmenopausal women.
15823822 2005 Lack of association between endometriosis and the CYP17 MspA1 polymorphism in UK and Japanese populations.
15799583 2005 CYP17 and tumor necrosis factor-alpha gene polymorphisms are associated with risk of oral cancer in Chinese patients in Taiwan.
15774541 2005 Estrogen-metabolizing gene polymorphisms and age at natural menopause in Caucasian women.
15761247 2005 Genetic polymorphism of CYP17 and breast cancer risk in Korean women.
15749482 2005 Estrogen receptor alpha dinucleotide repeat and cytochrome P450c17alpha gene polymorphisms are associated with susceptibility to endometriosis.
15711606 2005 Association between hormonal genetic polymorphisms and early-onset prostate cancer.
15706422 2005 CYP17 polymorphism as a risk factor of tamoxifen-induced hepatic steatosis in breast cancer patients.
15687493 2005 Regulation of 17,20 lyase activity by cytochrome b5 and by serine phosphorylation of P450c17.
15686129 2003 Cyp17 genetic polymorphism in prostate cancer and benign prostatic hyperplasia.
15663233 2004 [Relationship of msp AI polymorphism in cytochrome P450c 17alpha gene with bone mass and bone size in Shanghai men of Han nationality].
15654505 2005 Association of habitual smoking and drinking with single nucleotide polymorphism (SNP) in 40 candidate genes: data from random population-based Japanese samples.
15609124 2004 Association between the T27C polymorphism in the cytochrome P450 c17alpha (CYP17) gene and risk factors for breast cancer.
15604994 2004 CYP17 and SULT1A1 gene polymorphisms in Indian breast cancer.
15598676 2005 Dysregulation of cytochrome P450 17alpha-hydroxylase messenger ribonucleic acid stability in theca cells isolated from women with polycystic ovary syndrome.
15591802 2005 Estrogen-metabolizing gene COMT polymorphism synergistic APOE epsilon4 allele increases the risk of Alzheimer disease.
15583024 2004 Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.
15555906 2004 The cationic charges on Arg347, Arg358 and Arg449 of human cytochrome P450c17 (CYP17) are essential for the enzyme's cytochrome b5-dependent acyl-carbon cleavage activities.
15539439 2005 No association of estrogen receptor alpha and cytochrome P450c17alpha polymorphisms with age at menopause in a Dutch cohort.
15538743 2005 Association of CYP17, GSTP1, and PON1 polymorphisms with the risk of prostate cancer.
15536258 2004 Cytochrome P450c17alpha 5'-untranslated region *T/C polymorphism in endometriosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15482786 2004 Role of a CYP17 polymorphism in the regulation of circulating dehydroepiandrosterone sulfate levels in women with polycystic ovary syndrome.
15477877 2004 Serum sex steroid hormone levels and polymorphisms of CYP17 and SRD5A2: implication for prostate cancer risk.
15466495 2004 CYP17 gene polymorphisms: prevalence and associations with hormone levels and related factors. a HuGE review.
15382051 2004 An investigation of mammographic density and gene variants in healthy women.
15372520 2004 Association of CYP17 with HLA-B27-negative seronegative spondyloarthropathy in Japanese males.
15364798 2004 Possible association of heart failure status with synthetic balance between aldosterone and dehydroepiandrosterone in human heart.
15341023 2004 Polymorphisms of estrogen-metabolizing genes and risk of hepatocellular carcinoma in Taiwan females.
15241822 2004 Estrogen-metabolizing gene polymorphisms in the assessment of breast carcinoma risk and fibroadenoma risk in Caucasian women.
15235815 2005 Association of CYP17 gene polymorphism and rheumatoid arthritis in Chinese patients in central Taiwan.
15199113 2004 Polymorphisms associated with circulating sex hormone levels in postmenopausal women.
15195127 2002 No association of the 5' promoter region polymorphism of CYP17 gene with prostate cancer risk.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15129369 2004 Two single nucleotide polymorphisms in the CYP17 and COMT Genes--relation to bone mass and longitudinal bone changes in postmenopausal women with or without hormone replacement therapy. The Danish Osteoporosis Prevention Study.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15072828 2004 CYP17 and CYP19 genetic polymorphisms in endometrial cancer: association with intratumoral aromatase activity.
14995917 2004 A possible role of the cytochrome P450c17alpha gene (CYP17) polymorphism in the pathobiology of uterine leiomyomas from black South African women: a pilot study.
14985252 2004 Colocalization of P450c17 and cytochrome b5 in androgen-synthesizing tissues of the human.
14744739 2004 Association of CYP17, CYP19, CYP1B1, and COMT polymorphisms with serum and urinary sex hormone concentrations in postmenopausal women.
14715870 2004 Polymorphisms in the P450 c17 (17-hydroxylase/17,20-Lyase) and P450 c19 (aromatase) genes: association with serum sex steroid concentrations and bone mineral density in postmenopausal women.
14714492 [Association of polymorphism of genetic markers of CYP19 and CYP17 with sporadic breast cancer].
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14693733 2003 Comprehensive assessment of candidate genes and serological markers for the detection of prostate cancer.
14684846 2004 Increased cytochrome P450 17alpha-hydroxylase promoter function in theca cells isolated from patients with polycystic ovary syndrome involves nuclear factor-1.
14671162 2003 P450c17 deficiency in Brazilian patients: biochemical diagnosis through progesterone levels confirmed by CYP17 genotyping.
14665706 2004 A polymorphism in the CYP17 gene and intrauterine fetal growth restriction.
14644808 2003 Some new thoughts on the pathophysiology and genetics of polycystic ovary syndrome.
14634838 2003 Allele frequencies of single nucleotide polymorphisms (SNPs) in 40 candidate genes for gene-environment studies on cancer: data from population-based Japanese random samples.
14575568 2003 [Relation between single nucleotide polymorphism in estrogen-metabolizing genes COMT, CYP17 and breast cancer risk among Chinese women].
14561815 2003 A polymorphism in the CYP17 gene relates to the risk of recurrent pregnancy loss.
14552333 2003 Gene symbol: CYp17, M19489. Disease: 17-alpha-hydroxylase/17,20-lyase deficiency.
14552332 2003 Gene symbol: M19489, CYP17. Disease: 17-alpha-hydroxylase/17,20-lyase deficiency.
14512432 2004 Insulin augmentation of 17alpha-hydroxylase activity is mediated by phosphatidyl inositol 3-kinase but not extracellular signal-regulated kinase-1/2 in human ovarian theca cells.
14504283 2003 CYP17 mutation E305G causes isolated 17,20-lyase deficiency by selectively altering substrate binding.
12971967 2003 Genetic polymorphisms of steroid hormone metabolizing enzymes and risk of liver cancer in hepatitis C-infected patients.
12954495 CYP17 gene promoter allelic variant is not associated with prostate cancer.
12949806 2003 CYP17 polymorphisms in relation to risks of prostate cancer and benign prostatic hyperplasia: a population-based study in China.
12719950 2003 Vascular endothelial growth factor gene polymorphism is associated with calcium oxalate stone disease.
12718576 2002 Allele Frequencies of 25 Polymorphisms Pertaining to Cancer Risk for Japanese, Koreans and Chinese.
12692107 2003 The CYP3A4*1B variant is related to the onset of puberty, a known risk factor for the development of breast cancer.
12652520 2003 Regressive logistic and proportional hazards disease models for within-family analyses of measured genotypes, with application to a CYP17 polymorphism and breast cancer.
12645864 2003 Familial partial 17,20-desmolase and 17alpha-hydroxylase deficiency presenting as infertility.
12644832 2003 CYP17 promoter polymorphism and breast cancer risk in males and females in relation to BRCA2 status.
12631398 2003 CYP17 genetic polymorphism, breast cancer, and breast cancer risk factors.
12631293 2003 Assessment of porcine and human 16-ene-synthase, a third activity of P450c17, in the formation of an androstenol precursor. Role of recombinant cytochrome b5 and P450 reductase.
12602902 2003 Polymorphisms in steroid hormone pathway genes and mammographic density.
12584742 2003 HSD17B1 and CYP17 polymorphisms and breast cancer risk among Chinese women in Singapore.
12582021 2003 Association of the CYP17 gene polymorphism with the risk of prostate cancer: a meta-analysis.
12574216 2003 Estrogen-metabolizing gene polymorphisms, but not estrogen receptor-alpha gene polymorphisms, are associated with the onset of menarche in healthy postmenopausal Japanese women.
12530676 2002 Steroidogenic enzyme expression within the adrenal cortex during early human gestation.
12530662 2002 Transcriptional complexes at the CYP17 CRS.
12530647 2002 Towards a unifying mechanism for CYP17 mutations that cause isolated 17,20-lyase deficiency.
12530262 2002 [Genetic polymorphism of steroid 17 alpha-hydroxylase/17,20-lyase (CYP17) and hyperinsulinemia in endometrial carcinoma].
12517592 2003 Expression of messenger ribonucleic acid encoding steroidogenic enzymes in postmenopausal ovaries.
12506119 2003 CAMP-dependent protein kinase enhances CYP17 transcription via MKP-1 activation in H295R human adrenocortical cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466376 2002 Differential inhibition of 17alpha-hydroxylase and 17,20-lyase activities by three novel missense CYP17 mutations identified in patients with P450c17 deficiency.
12464252 2003 The enantiomer of progesterone (ent-progesterone) is a competitive inhibitor of human cytochromes P450c17 and P450c21.
12446594 2002 Molecular evolution of adrenarche: structural and functional analysis of p450c17 from four primate species.
12444089 2003 Protein phosphatase 2A and phosphoprotein SET regulate androgen production by P450c17.
12385014 2002 Relationship between serum hormone concentrations, reproductive history, alcohol consumption and genetic polymorphisms in pre-menopausal women.
12370109 2002 Impact of constitutional genetic variation in androgen/oestrogen-regulating genes on age-related changes in human prostate.
12368392 2002 The risk of breast cancer associated with dietary lignans differs by CYP17 genotype in women.
12164325 2002 Genotype frequencies of 50 polymorphisms for 241 Japanese non-cancer patients.
12036914 2002 Polymorphisms of the estrogen-metabolizing genes CYP17 and catechol-O-methyltransferase and risk of epithelial ovarian cancer.
12036913 2002 Effect of germ-line genetic variation on breast cancer survival in a population-based study.
11925378 2002 Association of the CYP17 gene and CYP19 gene polymorphisms with risk of endometriosis in Japanese women.
11897684 2002 Transcriptional activation of human CYP17 in H295R adrenocortical cells depends on complex formation among p54(nrb)/NonO, protein-associated splicing factor, and SF-1, a complex that also participates in repression of transcription.
11895872 2002 A polymorphism in the CYP17 gene and risk of prostate cancer.
11880540 2002 The CYP17 MspA1 polymorphism and breast cancer risk: a meta-analysis.
11867265 2002 Assessment of the ability of type 2 cytochrome b5 to modulate 17,20-lyase activity of human P450c17.
11847524 2002 Allelic frequencies of six polymorphic markers for risk of prostate cancer.
11839369 2002 Interactive effect of cytochrome P450 17alpha-hydroxylase and dopamine D3 receptor gene polymorphisms on abnormal involuntary movements in chronic schizophrenia.
11836339 2002 Combined 17alpha-Hydroxylase/17,20-lyase deficiency caused by Phe93Cys mutation in the CYP17 gene.
11749050 2001 CYP gene polymorphisms and early menarche.
11668516 2001 Linkage and association of CYP17 gene in hereditary and sporadic prostate cancer.
11571725 2001 Prostate carcinoma risk and allelic variants of genes involved in androgen biosynthesis and metabolism pathways.
11549685 2001 Pitfalls in characterizing P450c17 mutations associated with isolated 17,20-lyase deficiency.
11535545 2001 Cyp17 promoter variant associated with prostate cancer aggressiveness in African Americans.
11470993 2001 Extensive genetic polymorphism in the human CYP2B6 gene with impact on expression and function in human liver.
11440959 2001 The relationship between a polymorphism in CYP17 with plasma hormone levels and prostate cancer.
11379008 2001 Investigations on the genetic polymorphism in the region of CYP17 gene encoding 5'-UTR in patients with polycystic ovarian syndrome.
11358812 2001 A polymorphism in CYP17 and endometrial cancer risk.
11341336 2001 A common promotor variant in the cytochrome P450c17alpha (CYP17) gene is associated with bioavailability testosterone levels and bone size in men.
11303586 2001 The association between polymorphisms in the CYP17 and 5alpha-reductase (SRD5A2) genes and serum androgen concentrations in men.
11248649 2001 Association of vitamin D receptor and 17 hydroxylase gene polymorphisms with benign prostatic hyperplasia and benign prostatic enlargement.
11232039 2001 Evidence for association of polycystic ovary syndrome in caucasian women with a marker at the insulin receptor gene locus.
11221867 2001 Risk of endometrial cancer and estrogen replacement therapy history by CYP17 genotype.
11212283 2001 Building a multigenic model of breast cancer susceptibility: CYP17 and HSD17B1 are two important candidates.
11145739 2001 Expression profiles of SF-1, DAX1, and CYP17 in the human fetal adrenal gland: potential interactions in gene regulation.
11142420 2000 Steroid metabolism gene CYP17 polymorphism and the development of breast cancer.
11094312 2000 Genetic polymorphism in CYP17 and breast cancer risk in Japanese women.
11059764 2000 Increased risk of prostate cancer and benign prostatic hyperplasia associated with a CYP17 gene polymorphism with a gene dosage effect.
11036113 2000 CYP17 promoter polymorphism and breast cancer in Australian women under age forty years.
10720067 2000 17alpha-hydroxylase/17,20-lyase deficiency as a model to study enzymatic activity regulation: role of phosphorylation.
10406467 1999 Molecular modeling of human P450c17 (17alpha-hydroxylase/17,20-lyase): insights into reaction mechanisms and effects of mutations.
9888582 The molecular basis of isolated 17,20 lyase deficiency.
9601054 1998 Control of androgen biosynthesis in the human through the interaction of Arg347 and Arg358 of CYP17 with cytochrome b5.
9435441 1998 A new compound heterozygous mutation (W17X, 436 + 5G --> T) in the cytochrome P450c17 gene causes 17 alpha-hydroxylase/17,20-lyase deficiency.
9360545 1997 A single amino acid substitution in the putative redox partner-binding site of P450c17 as cause of isolated 17,20-lyase deficiency.
9326943 1997 The genetic and functional basis of isolated 17,20-lyase deficiency.
9177409 1997 A 5'-splice site mutation in the cytochrome P450 steroid 17alpha-hydroxylase gene in 17alpha-hydroxylase deficiency.
8855840 1996 Mutation of cytochrome P-45017 alpha gene (CYP17) in a Japanese patient previously reported as having glucocorticoid-responsive hyperaldosteronism: with a review of Japanese patients with mutations of CYP17.
8675607 1996 ACTH receptor, CYP11A1, CYP17 and CYP21A2 genes are expressed in skin.
8550762 1996 Mutation R96W in cytochrome P450c17 gene causes combined 17 alpha-hydroxylase/17-20-lyase deficiency in two French Canadian patients.
8396144 1993 Expression and purification of functional human 17 alpha-hydroxylase/17,20-lyase (P450c17) in Escherichia coli. Use of this system for study of a novel form of combined 17 alpha-hydroxylase/17,20-lyase deficiency.
8345056 1993 Deletion of amino acids Asp487-Ser488-Phe489 in human cytochrome P450c17 causes severe 17 alpha-hydroxylase deficiency.
8245018 1993 Mutation of histidine 373 to leucine in cytochrome P450c17 causes 17 alpha-hydroxylase deficiency.
8027220 1994 Point mutation of Arg440 to His in cytochrome P450c17 causes severe 17 alpha-hydroxylase deficiency.
7629254 1995 Seventeen alpha-hydroxylase deficiency with one base pair deletion of the cytochrome P450c17 (CYP17) gene.
6976525 1982 Hypokalemic myopathy associated with 17 alpha-hydroxylase deficiency: a case report.
3500022 1987 Cloning and sequence of the human gene for P450c17 (steroid 17 alpha-hydroxylase/17,20 lyase): similarity with the gene for P450c21.
3488328 1986 Assignment of the gene for adrenal P450c17 (steroid 17 alpha-hydroxylase/17,20 lyase) to human chromosome 10.
3274893 1987 Characterization of complementary deoxyribonucleic acid for human adrenocortical 17 alpha-hydroxylase: a probe for analysis of 17 alpha-hydroxylase deficiency.
3025870 1987 Cytochrome P450c17 (steroid 17 alpha-hydroxylase/17,20 lyase): cloning of human adrenal and testis cDNAs indicates the same gene is expressed in both tissues.
2843762 1988 Structural characterization of normal and mutant human steroid 17 alpha-hydroxylase genes: molecular basis of one example of combined 17 alpha-hydroxylase/17,20 lyase deficiency.
2808364 1989 Deletion of a phenylalanine in the N-terminal region of human cytochrome P-450(17 alpha) results in partial combined 17 alpha-hydroxylase/17,20-lyase deficiency.
2786493 1989 Identification of a common molecular basis for combined 17 alpha-hydroxylase/17,20-lyase deficiency in two Mennonite families.
2466376 1988 Clinical cancer: 31. Barriers to the management of cancer pain: the roles of patient and family.
2335573 1990 Combined 17 alpha-hydroxylase/17,20-lyase deficiency due to a 7-basepair duplication in the N-terminal region of the cytochrome P45017 alpha (CYP17) gene.
1964490 1990 Tissue-specific, cyclic adenosine 3',5'-monophosphate-induced, and phorbol ester-repressed transcription from the human P450c17 promoter in mouse cells.
1740503 1992 Compound heterozygous mutations (Arg 239----stop, Pro 342----Thr) in the CYP17 (P45017 alpha) gene lead to ambiguous external genitalia in a male patient with partial combined 17 alpha-hydroxylase/17,20-lyase deficiency.
1714904 1991 Missense mutation serine106----proline causes 17 alpha-hydroxylase deficiency.
1665206 1991 Deletion within the CYP17 gene together with insertion of foreign DNA is the cause of combined complete 17 alpha-hydroxylase/17,20-lyase deficiency in an Italian patient.
1621662 1992 Male pseudohermaphroditism resulting from 17 alpha-monooxygenase (P-450C17) deficiency in two unrelated Guamanians.
1577471 1992 Canadian Mennonites and individuals residing in the Friesland region of The Netherlands share the same molecular basis of 17 alpha-hydroxylase deficiency.
1515452 1992 Molecular basis of apparent isolated 17,20-lyase deficiency: compound heterozygous mutations in the C-terminal region (Arg(496)----Cys, Gln(461)----Stop) actually cause combined 17 alpha-hydroxylase/17,20-lyase deficiency.
1478654 1992 Localization of the human CYP17 gene (cytochrome P450(17 alpha)) to 10q24.3 by fluorescence in situ hybridization and simultaneous chromosome banding.
1347802 1992 Identification by molecular cloning of an autoantigen associated with Addison's disease as steroid 17 alpha-hydroxylase.