Property Summary

Ligand Count 488
NCBI Gene PubMed Count 103
PubMed Score 432.90
PubTator Score 312.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Congenital adrenal hyperplasia 73
Hypokalemia 52
Abnormal circulating aldosterone 2
Abnormal circulating renin 4
Abnormality of hair growth rate 1
Abnormality of prenatal development or birth 1
Abnormality of the menstrual cycle 4
Abnormality of the urinary system 21
Accelerated bone age after puberty 2
Adrenal hyperplasia 13
Adrenocorticotropic hormone excess 5
Adrenogenital Syndrome 6
Advanced bone age 35
Ambiguous genitalia due to virilization 9
Ambiguous genitalia, female 9
Aortic root dilatation 11
Autosomal recessive predisposition 1442
Decreased fertility in females 20
Decreased male fertility 7
Decreased plasma renin activity 9
Delayed bone age 136
Dexamethasone-suppresible primary hyperaldosteronism 2
Ectopic adrenal gland 2
Electrocardiogram abnormal 81
Enlarged polycystic ovaries 10
Familial primary hyperaldosteronism type 1 2
Female sexual dysfunction 2
Fluid overload 2
Fused labia minora 5
Generalized hyperpigmentation 22
Glucocorticoid-remediable familial primary aldosteronism 2
Hirsutism 47
Hyperpigmentation 37
Hyperpigmented genitalia 3
Hypertensive disease 292
Hypertrophy of clitoris 40
Hypoaldosteronism 12
Hypoplasia of vagina 14
Increase in blood pressure 119
Increased circulating ACTH level 8
Increased circulating androgen level 1
Increased size of penis 7
Infantile uterus 23
Low to undetectable plasma cortisol 12
Mineralocorticoid insufficiency 12
Neonatal onset 21
Osteoporosis 363
Penile melanosis 3
Precocious puberty in males 2
Premature adrenarche 3
Renal salt wasting 18
Rudimentary vagina 14
Short stature 531
Small testicle 75
Tall stature 34
Urogenital sinus anomaly 15
menstrual abnormality 4
Disease Target Count P-value
adrenocortical carcinoma 1428 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
adrenocortical carcinoma -2.914 1.2e-02

Gene RIF (79)

AA Sequence

MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQ      1 - 70
TFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFN     71 - 140
RLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLG    141 - 210
LVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAF    211 - 280
SRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAAS    281 - 350
ISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP    351 - 420
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILR    421 - 490
PSMFPLLTFRAIN                                                             491 - 503
//

Text Mined References (109)

PMID Year Title