Property Summary

NCBI Gene PubMed Count 132
PubMed Score 760.07
PubTator Score 574.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.800 3.4e-07
pituitary cancer 2.300 4.4e-05

Protein-protein Interaction (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
624313 screening 0 / 0 / 2 Late stage counterscreen for inhibitors of the orphan nuclear receptor subfamily 0, group B, member 1 (DAX1; NR0B1): absorbance-based cell-based assay to identify inhibitors of the DAX-1 target gene, cytochrome P450, family 11, subfamily A, polypeptide 1 (CYP11A1)

Gene RIF (113)

PMID Text
26750596 An epistatic effect between CYP11A1 and VDR polymorphisms may contribute to the predisposition to childhood asthma.
26631403 These findings contribute in clarifying the relationship between hormones regulating the early phase of steroidogenesis confirming that AMH is playing a suppressive role on CYP19A1 expression stimulated by gonadotropin in hGCs. Furthermore, a similar inhibitory effect for AMH was observed on P450scc gene expression when activated by gonadotropin treatment.
26603348 The study characterizes the intermediates in the second and third steps of the enzymatic process by which P450scc converts cholesterol to pregnenolone.
26332453 In prostate cancer, increased DNA methylation of SRD5A2 and CYP11A1 related to androgen biosynthesis functions may play a role in biochemical recurrence after patients' prostatectomy
25130438 Data indicate a role of cytochrome P450 11A1 (CYP11A1 in sterol metabolism.
24793009 CYP11A1 (tttta)(n) repeat polymorphism appeared to be a potential molecular marker for PCOS risk in our population. Gene-gene and gene-environmental interactions with respect to obesity may play a role in the early onset of this multifactorial condition.
24610422 There may be an association between CYP11A1 promoter pentanucleotide repeat polymorphism and polycystic ovary syndrome. (Meta-analysis)
24244276 the CYP11A1, CYP17A1, HSD3B2, SRD5A2, and HSD17B6 mRNA levels in metastases were significantly lower.
23852617 This meta-analysis suggests that CYP11A1 microsatellite [TTTA]n repeat polymorphisms may contribute to increasing susceptibility to polycystic ovary syndrome among Caucasian populations.
23756599 The results of this study demonistrated that Cyp11a1 is a target of SF-1 in gonadotroph cells and promotes proliferation/survival of rat pituitary adenoma primary cells and cell lines.
23555723 abnormally high expression of CYP11A inhibits trophoblastic proliferation and increases apoptosis and therefore could be involved in the pathogenesis of preeclampsia
23337730 study describes 7 patients with P450scc deficiency whose presentations ranged from severe neonatal adrenal crisis with wholly inactivating loss-of-function mutations in CYP11A1 to children who presented with normal male genitalia at up to 4 years of age
23330251 Mutations in the CYP11A1 gene encoding cholesterol side-chain cleavage enzyme cause disordered pregnenolone synthesis, and STAR mutations do not necessarily results in typical congenital lipoid adrenal hyperplasia.
23158025 deficiencies in the steroidogenic acute regulatory protein and the cholesterol side chain cleavage enzyme cause neonatal adrenal failure
22877869 Tissues expressing P450scc can metabolize 7-dehydrocholesterol to biologically active 7-dehydropregnenolone.
22699877 SNP rs4077582 in CYP11A1 is strongly associated with susceptibility to PCOS and may alter the testosterone levels by the regulation of LH in different genotypes. No association was observed in rs11632698.
22673022 Carriers of the CYP11A1 TCG haplotype had lower (P </= 0.017) left ventricular (LV) mass and LV mass index than noncarriers
22606018 polymorphisms of CYP11A1 are related to breast cancer susceptibility in Han Chinese women of South China.
22585829 NAD(+)-dependent SIRT deacetylase has a role in regulating the expression of mitochondrial steroidogenic P450
22227097 Features of the retinal environment which affect the activities and product profile of cholesterol-metabolizing cytochromes P450 CYP27A1 and CYP11A1.
22199361 Daxx, a HIPK kinase substrate in the apoptosis pathway, was phosphorylated by HIPK3 at Ser-669 in response to cAMP stimulation.
21880796 Evidence that partial CYP11A1 deficiency has to be considered as a differential diagnosis in clinically isolated adrenal insufficiency.
21771722 Repeat polymorphism in CYP11A1 is associated with Prostate Cancer.
21636783 Results present the crystal structure of the complex of human adrenodoxin and CYP11A1--the first of a complex between a eukaryotic CYP and its redox partner.
21557918 In PCOS patients, there was a correlation between UCP-2 and CYP11A1 expression, which was significantly higher than in the control group.
21520051 We have identified regions of the promoter that control CYP11A1 expression in the brain and embryonic adrenals.
21391350 promoter variability of CYP11A1 does not play a key role in the pathogenesis of PCOS
21195129 This article reviews recent studies on cis-regulatory elements and trans-regulators of the CYP11A1 promoter, with special focus on their tissue-specific regulation.
21164259 P450 side-chain cleavage deficiency--a rare cause of congenital adrenal hyperplasia.
21159840 Partial loss-of-function CYP11A1 mutation can present with a hormonal phenotype indistinguishable from nonclassic lipoid lipoid adrenal hyperplasia
20877624 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20450755 Polymorphism of CYP11A1 was associated with polycystic ovarian syndrome in Chinese patients.
20450755 Observational study of gene-disease association. (HuGE Navigator)
20381444 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20214802 Observational study of gene-disease association. (HuGE Navigator)
20200332 Observational study of gene-disease association. (HuGE Navigator)
20199803 Genetic variants in CYP11A1 may influence endometrial cancer risk or may be markers for causal variants elsewhere.
20199803 Observational study of gene-disease association. (HuGE Navigator)
20066577 No significant difference in P450(scc) mRNA was found among normal adrenal gland, APA or idiopathic hyperplastic nodules (P > 0.05). These results suggest that P450(scc) contributes little to the overproduction of aldosterone in APA and IHA.
19846611 Observational study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19574343 Observational study of gene-disease association. (HuGE Navigator)
19543524 20-Hydroxycholecalciferol, product of vitamin D3 hydroxylation by P450scc, decreases NF-kappaB activity by increasing IkappaB alpha levels in human keratinocytes
19453261 Observational study of gene-disease association. (HuGE Navigator)
19342447 Runx2 regulates enzymes involved in sterol/steroid-related metabolic pathways and that activation of Cyp11a1 by Runx2 may contribute to attenuation of osteoblast growth.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19300392 Promoter pentanucleotide variant may confer risk susceptibility in abnormal metabolism of patients with PCOS in Han Chinese women.
19300392 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19197249 Among patients with essential hypertension, cholesterol side-chain cleavage & MDR1 loci are related to circulating endogenous ouabain & diastolic blood pressure, most likely by influencing EO synthesis and transmembrane transport, respectively.
19197249 Observational study of gene-disease association. (HuGE Navigator)
19116240 A novel homozygous mutation in CYP11A1 gene is associated with late-onset adrenal insufficiency and hypospadias in a 46,XY patient.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18992638 A microsatellite polymorphism (TTTTA)n in the promoter region of the CYP11A1 gene is associated with an increased risk of metastatic and high-grade prostate cancer. with microsatellite instability as a potential markrs for early detection.
18992638 Observational study of gene-disease association. (HuGE Navigator)
18725155 Our study carried out in a defined group of Indian women with PCOS suggests for the first time an individual, as well as combined, association of polymorphisms in CYP11A1 and CYP17 promoters with T levels.
18725155 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18665078 Differential expression of steroidogenic factors 1 and 2, cytochrome p450scc, and steroidogenic acute regulatory protein in the pancreas.
18505908 Data show that CYP11A1 were expressed mainly in the zona fasciculata (ZF), followed by the zona reticularis in adrenal cortex attached to adrenocortical adenomas.
18499961 Observational study of gene-disease association. (HuGE Navigator)
18490834 Cholesterol sulfate has an inhibitory effect on progesterone production by regulating the expression of StAR and P450scc gene expression.
18483327 CYP11A1 pentanucleotide repeat polymorphism is associated with the risk of breast cancer but not fibrocystic breast disease in CHinese women.
18483327 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18437511 For CYP11A1 (cytochrome P450 family 11 subfamily A polypeptide 1), there was no association between the number of [TTTTA]( n ) repeats (D15S520) and risk of endometrial cancer
18437511 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18368131 data imply that the previously unreported pathway of vitamin D3 metabolism by P450scc may have wider biological implications depending, for example, on the extent of adrenal gland or cutaneous metabolism.
18307388 Observational study of genotype prevalence. (HuGE Navigator)
18191841 No difference in StAR and P450scc protein levels in granulosa cells obtained from older low-responder in vitro fertilization patients with that of young good-responder patients.
18182448 Severe combined adrenal and gonadal deficiency caused by novel mutations in the cholesterol side chain cleavage enzyme, P450scc.
18004979 An interaction exists among LBP transcriptional factors at the transcriptional level of P450scc regulation.
17615053 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17594537 A review of trans-acting factors and cis-acting elements that regulate CYP11A1 gene expression.
17575134 Observational study of gene-disease association. (HuGE Navigator)
17575134 study found that among genes controlling endogenous estrogen metabolism, CYP11A1 harbors common variants that may influence expression to significantly modify risk of breast cancer
17507624 Observational study of gene-disease association. (HuGE Navigator)
17178901 Observational study of gene-disease association. (HuGE Navigator)
17178901 CYP11A should be considered as a candidate breast cancer susceptibility gene in men and women.
17110639 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
17065579 Leydig cells (LCs) of GR1 and GR2 showed strong immunostaining of aromatase and cP450scc but weak staining of ERbeta and AR. Interstitial cells (ICs) and Sertoli cells (SCs) expressed ERbeta, particularly in GR1 and GR2
16798289 Although granulosa cells in arrested follicles in PCOS fail to express significant amounts of aromatase, there is an overexpression of 5alpha-reductase activity and premature expression of cholesterol side-chain cleavage cytochrome P450.
16764871 Observational study of gene-disease association. (HuGE Navigator)
16409859 Observational study of gene-disease association. (HuGE Navigator)
16391898 Observational study of gene-disease association. (HuGE Navigator)
16391898 An association between the (TTTTA)(n) microsatellite polymorphism in the promoter of the CYP11A gene and the pathogenesis of ovarian hyperstimulation syndrome could not be confirmed.
16195240 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16172228 Observational study of gene-disease association. (HuGE Navigator)
16116976 Observational study of gene-disease association. (HuGE Navigator)
16103457 Observational study of gene-disease association. (HuGE Navigator)
15927889 CYP11A1 induces apoptosis by the generation of reactive oxygen species in mitochondria
15793791 Observational study of gene-disease association. (HuGE Navigator)
15613430 CYP11A1 expression in human granulosa cells is regulated by LRH-1.
15471945 LBP-1b is an important SF1-independent transcriptional activator stimulating P450scc expression in human placental JEG-3 cells, whereas LBP-9 modulates the action of LBP-1b, exerting both positive and negative effects
15323426 Findings suggest that the syncytiotrophoblast cells are the major site expressing P450scc in early placenta, and that increasing P450scc in placental villi lay a foundation for site-shift of progesterone biosynthesis from the corpus luteum to placenta.
15159300 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15159300 CYP11A1 polymorphism near the promoter region may be an important susceptibility factor for breast cancer risk.
15126571 Observational study of gene-disease association. (HuGE Navigator)
15126571 Associations between CYP11A promoter variation and androgen-related phenotypes has been substantially overestimated in previous studies.
15054879 Observational study of gene-disease association. (HuGE Navigator)
14644808 CYP11A mRNAs were more abundant in polycystic ovary syndrome theca cells than in normal theca cells.
12530676 CYP11A and CYP17 expressed centrally within fetal zone at 50 days post-conception and later during first trimester. Weaker CYP11A immunoreactivity also was visible in outer region of adrenal cortex consistent with definitive zone expresion.
12530663 TReP-132 interacts with steroidogenic factor-1 (SF-1) through specific domains; and along with the interaction with CBP/p300 these factors are postulated to form a complex to regulate expression of the P450scc gene.
12517592 cytochrome P450 side chain cleavage mRNA was increased threefold in the ovarian stroma of postmenopausal women with endometrial cancer and endometrial hyperplasia
12385014 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12242026 Results support the hypothesis that NO inhibits the rate-limiting enzyme CYP11A1 in steroidogenesis independent of guanylyl cyclase activation.
12145340 Transcription of cholesterol side-chain cleavage cytochrome P450 in the placenta: activating protein-2 assumes the role of steroidogenic factor-1 by binding to an overlapping promoter element.
12137805 cholesterol is near-saturating for cytochrome P450scc activity in placental mitochondria due to the P450scc displaying a low K(m) for cholesterol resulting from the low and rate-limiting concentration of adrenodoxin reductase present
12101186 p450scc expression is regulated by TReP-132, steroidogenic factor-1 and CBP/p300
11864972 Salt-inducible kinase represses cAMP-dependent protein kinase-mediated activation of cyp11a promoter through the CREB basic leucine zipper domain
11137199 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11062177 Observational study of gene-disease association. (HuGE Navigator)
11008920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWLNLYHFWRETG      1 - 70
THKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVL     71 - 140
LKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESI    141 - 210
TNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY    211 - 280
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQD    281 - 350
MLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIY    351 - 420
ALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHL    421 - 490
SDVGTTFNLILMPEKPISFTFWPFNQEATQQ                                           491 - 521
//

Text Mined References (134)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26750596 2016 1,25D3 prevents CD8(+)Tc2 skewing and asthma development through VDR binding changes to the Cyp11a1 promoter.
26631403 2016 The anti-Müllerian hormone (AMH) acts as a gatekeeper of ovarian steroidogenesis inhibiting the granulosa cell response to both FSH and LH.
26603348 2015 Evidence That Compound I Is the Active Species in Both the Hydroxylase and Lyase Steps by Which P450scc Converts Cholesterol to Pregnenolone: EPR/ENDOR/Cryoreduction/Annealing Studies.
26332453 2015 DNA methylation screening of primary prostate tumors identifies SRD5A2 and CYP11A1 as candidate markers for assessing risk of biochemical recurrence.
25130438 2014 Lumisterol is metabolized by CYP11A1: discovery of a new pathway.
24793009 2014 CYP11A1 microsatellite (tttta)n polymorphism in PCOS women from South India.
24610422 2014 Polymorphisms of pentanucleotide repeats (tttta)n in the promoter of CYP11A1 and their relationships to polycystic ovary syndrome (PCOS) risk: a meta-analysis.
24244276 2013 Characterization of prostate cancer bone metastases according to expression levels of steroidogenic enzymes and androgen receptor splice variants.
23852617 2014 Common polymorphisms in the CYP1A1 and CYP11A1 genes and polycystic ovary syndrome risk: a meta-analysis and meta-regression.
23756599 2013 Transcriptome analysis of MENX-associated rat pituitary adenomas identifies novel molecular mechanisms involved in the pathogenesis of human pituitary gonadotroph adenomas.
23555723 2013 Abnormal apoptosis of trophoblastic cells is related to the up-regulation of CYP11A gene in placenta of preeclampsia patients.
23337730 2013 Varied clinical presentations of seven patients with mutations in CYP11A1 encoding the cholesterol side-chain cleavage enzyme, P450scc.
23330251 2012 Genetic defects in pregnenolone synthesis.
23158025 2013 Distinguishing deficiencies in the steroidogenic acute regulatory protein and the cholesterol side chain cleavage enzyme causing neonatal adrenal failure.
22877869 2012 Cytochrome P450scc-dependent metabolism of 7-dehydrocholesterol in placenta and epidermal keratinocytes.
22699877 2012 Association between polymorphisms of the CYP11A1 gene and polycystic ovary syndrome in Chinese women.
22673022 2012 Left ventricular structure and function in relation to steroid biosynthesis genes in a white population.
22606018 2012 Risk-association of CYP11A1 polymorphisms and breast cancer among Han Chinese women in Southern China.
22585829 2012 Resveratrol stimulates cortisol biosynthesis by activating SIRT-dependent deacetylation of P450scc.
22227097 2012 Features of the retinal environment which affect the activities and product profile of cholesterol-metabolizing cytochromes P450 CYP27A1 and CYP11A1.
22199361 2012 Death-associated protein 6 (Daxx) mediates cAMP-dependent stimulation of Cyp11a1 (P450scc) transcription.
21880796 2011 A novel entity of clinically isolated adrenal insufficiency caused by a partially inactivating mutation of the gene encoding for P450 side chain cleavage enzyme (CYP11A1).
21771722 2011 Repeat polymorphisms in estrogen metabolism genes and prostate cancer risk: results from the Prostate Cancer Prevention Trial.
21636783 2011 Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
21557918 2011 Abnormal expression of uncoupling protein-2 correlates with CYP11A1 expression in polycystic ovary syndrome.
21520051 2011 Differential regulation of the human CYP11A1 promoter in mouse brain and adrenals.
21391350 2010 [(TTTTA), polymorphism in the promoter of the CYP11A1 gene in the pathogenesis of polycystic ovary syndrome].
21195129 2011 Regulation of steroid production: analysis of Cyp11a1 promoter.
21164259 2011 P450 side-chain cleavage deficiency--a rare cause of congenital adrenal hyperplasia.
21159840 2011 Partial defect in the cholesterol side-chain cleavage enzyme P450scc (CYP11A1) resembling nonclassic congenital lipoid adrenal hyperplasia.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20450755 2010 [Polymorphism of CYP11A1 gene in Chinese patients with polycystic ovarian syndrome].
20381444 2010 Polymorphisms in genes of the steroid hormone biosynthesis and metabolism pathways and endometrial cancer risk.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
20199803 2010 Genetic variation in CYP11A1 and StAR in relation to endometrial cancer risk.
20066577 2010 A dispensable role for P450(scc) in the overproduction of aldosterone in aldosterone-producing adenoma and idiopathic hyperaldosteronism in patients with primary aldosteronism.
19846611 2009 The spontaneous Ala147Thr amino acid substitution within the translocator protein influences pregnenolone production in lymphomonocytes of healthy individuals.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19543524 2009 20-Hydroxycholecalciferol, product of vitamin D3 hydroxylation by P450scc, decreases NF-kappaB activity by increasing IkappaB alpha levels in human keratinocytes.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19342447 2009 The osteogenic transcription factor runx2 controls genes involved in sterol/steroid metabolism, including CYP11A1 in osteoblasts.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19300392 2009 Evaluation of association between the CYP11alpha promoter pentannucleotide (TTTTA)n polymorphism and polycystic ovarian syndrome among Han Chinese women.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19197249 2009 Steroid biosynthesis and renal excretion in human essential hypertension: association with blood pressure and endogenous ouabain.
19116240 2009 A novel homozygous mutation in CYP11A1 gene is associated with late-onset adrenal insufficiency and hypospadias in a 46,XY patient.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18992638 2008 The presence of the CYP11A1 (TTTTA)6 allele increases the risk of biochemical relapse in organ confined and low-grade prostate cancer.
18725155 2009 CYP11A1 and CYP17 promoter polymorphisms associate with hyperandrogenemia in polycystic ovary syndrome.
18665078 2008 Differential expression of steroidogenic factors 1 and 2, cytochrome p450scc, and steroidogenic acute regulatory protein in human pancreas.
18505908 2008 Analysis of mRNA expression for steroidogenic enzymes in the remaining adrenal cortices attached to adrenocortical adenomas.
18499961 2008 [Polymorphism in CYP11alpha and CYP17 genes and the etiology of hyperandrogenism in patients with polycystic ovary syndrome].
18490834 2008 Inhibitory effects of cholesterol sulfate on progesterone production in human granulosa-like tumor cell line, KGN.
18483327 2008 Polymorphisms in steroid hormone biosynthesis genes and risk of breast cancer and fibrocystic breast conditions in Chinese women.
18437511 2008 Variants in hormone biosynthesis genes and risk of endometrial cancer.
18368131 2008 20-Hydroxyvitamin D3, a product of vitamin D3 hydroxylation by cytochrome P450scc, stimulates keratinocyte differentiation.
18307388 2008 Frequencies of promoter pentanucleotide (TTTTA)n of CYP11A gene in European and North African populations.
18191841 2009 Levels of steroidogenic acute regulatory protein and mitochondrial membrane potential in granulosa cells of older poor-responder women.
18182448 2008 Severe combined adrenal and gonadal deficiency caused by novel mutations in the cholesterol side chain cleavage enzyme, P450scc.
18004979 2008 LBP-1b, LBP-9, and LBP-32/MGR detected in syncytiotrophoblasts from first-trimester human placental tissue and their transcriptional regulation.
17615053 2007 Polymorphisms in the cytochrome P450 genes CYP1A2, CYP1B1, CYP3A4, CYP3A5, CYP11A1, CYP17A1, CYP19A1 and colorectal cancer risk.
17594537 2007 Transcriptional regulation of human CYP11A1 in gonads and adrenals.
17575134 2007 Haplotype analysis of CYP11A1 identifies promoter variants associated with breast cancer risk.
17507624 2007 Evaluation of genetic variations in the androgen and estrogen metabolic pathways as risk factors for sporadic and familial prostate cancer.
17178901 2006 A systematic assessment of common genetic variation in CYP11A and risk of breast cancer.
17110639 2007 Variants in estrogen biosynthesis genes, sex steroid hormone levels, and endometrial cancer: a HuGE review.
17065579 2006 Expression of aromatase, estrogen receptor alpha and beta, androgen receptor, and cytochrome P-450scc in the human early prepubertal testis.
16798289 2006 Ovarian enzyme activities in women with polycystic ovary syndrome.
16764871 2006 A microsatellite polymorphism (tttta)n in the promoter of the CYP11a gene in Chinese women with polycystic ovary syndrome.
16705068 2006 Homozygous mutation of P450 side-chain cleavage enzyme gene (CYP11A1) in 46, XY patient with adrenal insufficiency, complete sex reversal, and agenesis of corpus callosum.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16409859 2005 [Microsatellite polymorphism of (tttta) n in the promoter of CYP11a gene in Chinese women with polycystic ovary syndrome].
16391898 2006 No association between the microsatellite polymorphism (TTTTA)n in the promoter of the CYP11A gene and ovarian hyperstimulation syndrome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16195240 2006 CYP1A1 Ile462Val and MPO G-463A interact to increase risk of adenocarcinoma but not squamous cell carcinoma of the lung.
16172228 2005 Role of androgen metabolism genes CYP1B1, PSA/KLK3, and CYP11alpha in prostate cancer risk and aggressiveness.
16116976 2005 Role of the pentanucleotide (tttta)n polymorphisms of Cyp11alpha gene in the pathogenesis of hyperandrogenism in Chinese women with polycystic ovary syndrome.
16103457 2005 Identifying susceptibility genes for prostate cancer--a family-based association study of polymorphisms in CYP17, CYP19, CYP11A1, and LH-beta.
15927889 2005 Adrenodoxin (Adx) and CYP11A1 (P450scc) induce apoptosis by the generation of reactive oxygen species in mitochondria.
15793791 2005 [Relationship between the microsatellite polymorphism of CYP11 alpha gene and the pathogenesis of hyperandrogenism of polycystic ovary syndrome in Chinese].
15613430 2005 The orphan nuclear receptor, liver receptor homolog-1, regulates cholesterol side-chain cleavage cytochrome p450 enzyme in human granulosa cells.
15583024 2004 Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471945 2005 LBP proteins modulate SF1-independent expression of P450scc in human placental JEG-3 cells.
15323426 2004 [Expression of cytochrome P450scc in human early placenta].
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15159300 2004 Population-based case-control study of CYP11A gene polymorphism and breast cancer risk.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15126571 2004 Large-scale analysis of the relationship between CYP11A promoter variation, polycystic ovarian syndrome, and serum testosterone.
15054879 2004 Microsatellite polymorphism of steroid hormone synthesis gene CYP11A1 is associated with advanced prostate cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14644808 2003 Some new thoughts on the pathophysiology and genetics of polycystic ovary syndrome.
12530676 2002 Steroidogenic enzyme expression within the adrenal cortex during early human gestation.
12530663 2002 Function of the transcriptional regulating protein of 132 kDa (TReP-132) on human P450scc gene expression.
12517592 2003 Expression of messenger ribonucleic acid encoding steroidogenic enzymes in postmenopausal ovaries.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12385014 2002 Relationship between serum hormone concentrations, reproductive history, alcohol consumption and genetic polymorphisms in pre-menopausal women.
12242026 2002 Nitric oxide potently inhibits the rate-limiting enzymatic step in steroidogenesis.
12161514 2002 Compound heterozygous mutations in the cholesterol side-chain cleavage enzyme gene (CYP11A) cause congenital adrenal insufficiency in humans.
12145340 2002 Transcription of cholesterol side-chain cleavage cytochrome P450 in the placenta: activating protein-2 assumes the role of steroidogenic factor-1 by binding to an overlapping promoter element.
12137805 2002 Placental cytochrome P450scc (CYP11A1): comparison of catalytic properties between conditions of limiting and saturating adrenodoxin reductase.
12101186 2002 The transcriptional regulating protein of 132 kDa (TReP-132) enhances P450scc gene transcription through interaction with steroidogenic factor-1 in human adrenal cells.
11997174 2002 Steroidogenic enzyme gene expression in the human brain.
11864972 2002 Salt-inducible kinase represses cAMP-dependent protein kinase-mediated activation of human cholesterol side chain cleavage cytochrome P450 promoter through the CREB basic leucine zipper domain.
11701663 2001 Cardiac steroidogenesis in the normal and failing heart.
11535251 2001 Genetic susceptibility and environmental estrogen-like compounds.
11502818 2001 Heterozygous mutation in the cholesterol side chain cleavage enzyme (p450scc) gene in a patient with 46,XY sex reversal and adrenal insufficiency.
11238527 2001 Luteinizing hormone receptor, steroidogenesis acute regulatory protein, and steroidogenic enzyme messenger ribonucleic acids are overexpressed in thecal and granulosa cells from polycystic ovaries.
11137199 2000 Gender differences in genetic susceptibility for lung cancer.
11062177 2000 Interindividual variation in CYP1A1 expression in breast tissue and the role of genetic polymorphism.
11008920 2000 CYP1A1 I462V genetic polymorphism and lung cancer risk in a cohort of men in Shanghai, China.
10856721 2000 Intramitochondrial cholesterol transfer.
10644752 2000 Cloning of factors related to HIV-inducible LBP proteins that regulate steroidogenic factor-1-independent human placental transcription of the cholesterol side-chain cleavage enzyme, P450scc.
10416690 1999 Synthesis of steroids in pancreas: evidence of cytochrome P-450scc activity.
10411633 1999 Interaction of CYP11B1 (cytochrome P-45011 beta) with CYP11A1 (cytochrome P-450scc) in COS-1 cells.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9685215 1998 Prominent sex steroid metabolism in human lymphocytes.
9498238 1998 Expression of cytochrome P450 genes encoding enzymes active in the metabolism of tamoxifen in human uterine endometrium.
9147642 1997 Association of the steroid synthesis gene CYP11a with polycystic ovary syndrome and hyperandrogenism.
9029710 1997 Peripheral benzodiazepine receptor in cholesterol transport and steroidogenesis.
8372604 1993 Twin genes and endocrine disease: CYP21 and CYP11B genes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3038854 1987 Gene structure of human cytochrome P-450(SCC), cholesterol desmolase.
3024157 1986 Human cholesterol side-chain cleavage enzyme, P450scc: cDNA cloning, assignment of the gene to chromosome 15, and expression in the placenta.
2419119 1986 Study of cholesterol side-chain cleavage (20,22 desmolase) deficiency causing congenital lipoid adrenal hyperplasia using bovine-sequence P450scc oligodeoxyribonucleotide probes.
1917982 1991 Site-specific mutations in human ferredoxin that affect binding to ferredoxin reductase and cytochrome P450scc.
1863359 1991 Regional mapping of genes encoding human steroidogenic enzymes: P450scc to 15q23-q24, adrenodoxin to 11q22; adrenodoxin reductase to 17q24-q25; and P450c17 to 10q24-q25.
1849407 1991 Regulated expression of cytochrome P-450scc (cholesterol-side-chain cleavage enzyme) in cultured cell lines detected by antibody against bacterially expressed human protein.
1429635 1992 Identification by site-directed mutagenesis of two lysine residues in cholesterol side chain cleavage cytochrome P450 that are essential for adrenodoxin binding.