Property Summary

NCBI Gene PubMed Count 34
PubMed Score 20.19
PubTator Score 14.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -1.400 1.8e-02
ependymoma -2.200 5.7e-12
cutaneous lupus erythematosus 1.600 1.7e-03
glioblastoma -2.900 2.2e-06
oligodendroglioma -1.200 4.4e-13
osteosarcoma -2.456 4.5e-03
sonic hedgehog group medulloblastoma -1.900 6.1e-08
cystic fibrosis -1.831 3.7e-06
atypical teratoid / rhabdoid tumor -2.300 5.1e-10
medulloblastoma, large-cell -2.100 3.9e-05
primitive neuroectodermal tumor -1.300 9.5e-04
tuberculosis 1.100 3.3e-06
non-small cell lung cancer -1.165 5.6e-10
lung cancer -1.400 3.7e-02
interstitial cystitis 1.100 1.2e-02
pediatric high grade glioma -2.700 3.6e-10
pilocytic astrocytoma -1.200 1.6e-05
primary Sjogren syndrome 1.700 4.0e-05
subependymal giant cell astrocytoma -2.080 2.3e-02
lung carcinoma 1.700 2.1e-25
Pick disease -1.200 7.2e-03
ductal carcinoma in situ 1.200 1.0e-02
pituitary cancer -1.200 1.2e-06

Gene RIF (8)

PMID Text
22430187 blood samples of lateral sclerosis patients were found to have significantly different levels of expression of CyFIP2 and RbBP9 compared to the levels of expression in control subjects.
22268788 Increased expression of the cytoplasmic FMR1-interacting protein 2 (CYFIP2), a known FMRP interactor, is detected in fragile X syndrome.
21252116 Studies identify a novel proapoptotic gene target, CYFIP2, which is downregulated by IMP-1, and mediates the regulation of cell survival and K-Ras expression in colon cancer cells.
20228810 Protein complexes containing CYFIP/Sra/PIR121 coordinate Arf1 and Rac1 signalling during clathrin-AP-1-coated carrier biogenesis at the trans-golgi network.
19951440 Observational study of gene-disease association. (HuGE Navigator)
19910030 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
17245118 The CYFIP2 promoter contains a p53-responsive element that confers p53 binding as well as transcriptional activation of a heterologous reporter.

AA Sequence

MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMN      1 - 70
EMLEEGHEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEV     71 - 140
KRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNL    141 - 210
SMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSN    211 - 280
IYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKWTCTQSSISPQYNICEQMV    281 - 350
QIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTD    351 - 420
KFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVT    421 - 490
LREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKGGFDIKVPRRAVGPSSTQACQ    491 - 560
WSPRALFHPTGGTQGRRGCRSLLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLL    561 - 630
NISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAY    631 - 700
YALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNYGVIIPYPPSNRY    701 - 770
ETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHM    771 - 840
TLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPY    841 - 910
YLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVM    911 - 980
PKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAA    981 - 1050
PFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVI   1051 - 1120
LTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIV   1121 - 1190
LLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTV   1191 - 1260
EHVRCFQPPIHQSLATTC                                                       1261 - 1278
//

Text Mined References (37)

PMID Year Title
24658146 2014 Subcellular fractionation and localization studies reveal a direct interaction of the fragile X mental retardation protein (FMRP) with nucleolin.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22430187 2012 Two potential biomarkers identified in mesenchymal stem cells and leukocytes of patients with sporadic amyotrophic lateral sclerosis.
22268788 2012 Altered mTOR signaling and enhanced CYFIP2 expression levels in subjects with fragile X syndrome.
21269460 2011 Initial characterization of the human central proteome.
21252116 2011 IMP-1 displays cross-talk with K-Ras and modulates colon cancer cell survival through the novel proapoptotic protein CYFIP2.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20228810 2010 Protein complexes containing CYFIP/Sra/PIR121 coordinate Arf1 and Rac1 signalling during clathrin-AP-1-coated carrier biogenesis at the TGN.
19951440 2009 Analyses of associations between three positionally cloned asthma candidate genes and asthma or asthma-related phenotypes in a Chinese population.
19946888 2010 Defining the membrane proteome of NK cells.
19910030 2010 Evaluation of candidate genes in a genome-wide association study of childhood asthma in Mexicans.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18387192 2008 A pathway sensor for genome-wide screens of intracellular proteolytic cleavage.
17245118 2007 CYFIP2, a direct p53 target, is leptomycin-B sensitive.
16381901 2006 The LIFEdb database in 2006.
15731336 2005 Evolutionarily conserved human targets of adenosine to inosine RNA editing.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15048733 2004 CYFIP2 is highly abundant in CD4+ cells from multiple sclerosis patients and is involved in T cell adhesion.
15048123 2004 Abi1 is essential for the formation and activation of a WAVE2 signalling complex.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14506234 2003 Tuba, a novel protein containing bin/amphiphysin/Rvs and Dbl homology domains, links dynamin to regulation of the actin cytoskeleton.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12181570 2002 Mechanism of regulation of WAVE1-induced actin nucleation by Rac1 and Nck.
11438699 2001 A highly conserved protein family interacting with the fragile X mental retardation protein (FMRP) and displaying selective interactions with FMRP-related proteins FXR1P and FXR2P.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
10449408 1999 Increased apoptosis induction by 121F mutant p53.
9463375 1998 In mouse brain profilin I and profilin II associate with regulators of the endocytic pathway and actin assembly.
8605018 1996 Molecular cloning of p125Nap1, a protein that associates with an SH3 domain of Nck.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.