Property Summary

NCBI Gene PubMed Count 101
PubMed Score 4771.42
PubTator Score 8760.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
hepatocellular carcinoma -2.300 5.0e-04
astrocytic glioma -1.700 3.1e-03
ependymoma -1.700 1.4e-02
oligodendroglioma -1.400 9.5e-03
osteosarcoma 3.726 9.0e-05
glioblastoma -2.000 1.6e-05
atypical teratoid / rhabdoid tumor -2.500 6.1e-06
medulloblastoma -1.100 5.0e-03
medulloblastoma, large-cell -1.500 4.6e-04
intraductal papillary-mucinous adenoma (... 1.300 2.7e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.3e-02
ulcerative colitis -1.700 1.4e-08
pediatric high grade glioma -1.800 1.0e-06
pilocytic astrocytoma -1.300 6.3e-06
aldosterone-producing adenoma -1.544 2.3e-02
Pick disease 1.500 1.7e-02
invasive ductal carcinoma -1.200 1.9e-02
psoriasis 1.400 3.8e-69

 OMIM Phenotype (1)

Gene RIF (63)

PMID Text
26216969 These findings establish a framework for understanding the molecular basis of cytochrome c-mediated blocking of SET/TAF-Ibeta.
25578497 Monitoring of serum cytochrome c might also serve as a sensitive apoptotic marker in vivo reflecting chemotherapy-induced cell death burden in patients with non-small cell lung cancer.
25275009 The mitochondrial metalloprotease OMA1 was activated in a Bax- and Bak-dependent fashion.
25028650 In vitro ultrastructural changes of MCF-7 for metastasise bone cancer and induction of apoptosis via mitochondrial cytochrome C released by CaCO3/Dox nanocrystals
24886575 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
24739951 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
24556695 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
24488929 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
24329121 proposed that mutation of residue 41, and interaction with cardiolipin, increase peroxidase activity by altering the 40-57 Omega loop and its hydrogen bond network with the propionate of haem ring A; these changes enhance access of hydrogen peroxide and substrate to the haem
24326104 Data indicate a novel missense mutation (Y48H) of the cytochrome c (CYCS) gene responsible for thrombocytopenia.
24099549 a mechanism of multiple radical formations in the cytochrome c-phospholipid complexes under H2O2 treatment, consistent with the stabilization of the radical in the G41S mutant, which elicits a greater peroxidase activity from cytochrome c
23443079 G-Rh2 causes rapid and dramatic translocation of both Bak and Bax, which subsequently triggers mitochondrial cytochrome c release and consequent caspase activation.
23364796 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
23334161 results suggest the impact of residue 41 on the conformation of cytochrome c influences its ability to act in both of its physiological roles, electron transport and caspase activation
23207240 Data indicate that the formation of cytochrome c-Apaf-1 apoptosome and the presence of Smac are absolutely required for PSAP-induced apoptosis.
23150584 Spectroscopic analyses of HCCS alone and complexes of HCCS with site-directed variants of cytochrome c revealed the fundamental steps of heme attachment and maturation.
23070294 structural characterization of cytochrome c in micelle
22632162 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
22552851 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
22363611 CCN1 promotes the activation of p53 and p38 MAPK, which mediate enhanced cytochrome c release to amplify the cytotoxicity of TNFalpha.
22320973 The levels of cellular apoptosis-associated proteins such as Smac/DIABLO, Cyto C, and the activated fragment of caspase-3 increased in pancreatic cancer cells, but the expression of XIAP was significantly decreased after 24 h treatment with the combination of TRAIL and gemcitabine.
22216281 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
22192356 Specific nitration of tyrosines 46 and 48 makes cytochrome c assemble a non-functional apoptosome.
22184220 Dynamic changes in cytochrome c distribution at the Raman band of 750 cm(-1) were observed after adding an apoptosis inducer to the cells.
22157762 mitochondrial import and direct electron transfer from cytochrome c to Rac1 modulates mitochondrial H(2)O(2) production in alveolar macrophages pulmonary fibrosis.
22102269 Studies indicate that the CYCS mutation in TP Cargeegis a glycine 41 replacement by serine, which yields a cytochrome C variant with enhanced apoptotic pathway activity in vitro.
21869827 Translocation of ARTS initiates a first wave of caspase activation leading to the subsequent release of additional mitochondrial factors, including cytochrome C and SMAC/Diablo.
21751259 Data show that G-Rh2 and Bet A cooperated to induce Bax traslocation to mitochondria and cytochrome c release, and enhanced cleavage of caspase-8 and Bid.
21712378 Resveratrol induces p53-independent, X-linked inhibitor of apoptosis protein (XIAP)-mediated Bax protein oligomerization on mitochondria to initiate cytochrome c release and caspase activation.
21706253 Tyrosine phosphorylation turns alkaline transition into a biologically relevant process and makes human cytochrome c behave as an anti-apoptotic switch.
21448217 Cerebrospinal fluid Bcl-2 and cytochrome C levels are elevated in adults after severe traumatic brain injury.
21192676 heme electronic structure change may ultimately be responsible for the enhanced proapoptotic activity of G41S mutated human cyt c
20877624 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20227384 it is the specific nitration of solvent-exposed Tyr74 which enhances the peroxidase activity and blocks the ability of cytochrome c to activate caspase-9, thereby preventing the apoptosis signaling pathway
19895853 NOA36/ZNF330 is translocated from the mitochondria to the cytoplasm when apoptosis is induced and that it contributes to cytochrome c release.
19875445 Membrane-associated XIAP induces mitochondrial outer membrane permeabilization leading to cytochrome c and Smac release, which is dependent on Bax and Bak.
19851871 Serum LRG when bound to extracellular Cyt c that is released from apoptotic cells acts as a survival factor for lymphocytes and possibly other cells that are susceptible to the toxic effect of extracellular Cyt c.
19812265 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
19770576 Data show that sorafenib initiated lethal apoptotic process through the release of cytochrome c and caspase 3/7 activation.
19640329 No difference in the serum level of cytochrome c was seen among the the groups of patients with type 2 diabetes, controls or in subjects with IGT.
19458171 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
19404857 there was no evidence of somatic mutations of CYTOCHROME C in the cancers
19172527 Observational study of gene-disease association. (HuGE Navigator)
19172527 In 77 Italian patients with inherited thrombocytopenia and clinical and laboratory features similar to those of patients with the CYCS missense (Gly41Ser) mutation, no alterations of the open reading frame were identified.
19029908 Both neurons and cancer cells strictly inhibit cytochrome c-mediated apoptosis by a mechanism dependent on glucose metabolism.
18976975 Knockdown of cytochrome c, somatic (CYCS) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18973553 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
18825408 Serum cyto-c is a potent tumor marker as a predictor for malignant potential in several different types of cancer.
18417609 MICS1 individually functions in mitochondrial morphology and cytochrome c release.
18345000 Mutation of human cytochrome c enhances the intrinsic apoptotic pathway and causes thrombocytopenia
17409234 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
16934433 non-rare allelic variants of the Cyt c protein are absent in the populations analyzed in this study
16520893 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
15698476 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
15691386 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
15033690 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
12404116 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
12019321 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
11839755 galectin-3 is enriched in the mitochondria and prevents mitochondrial damage and cytochrome c release
11739707 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
11462036 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
11193032 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells

AA Sequence

MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLE      1 - 70
NPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE                                        71 - 105
//

Text Mined References (107)

PMID Year Title
26216969 2015 Structural basis for inhibition of the histone chaperone activity of SET/TAF-I? by cytochrome c.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25595453 2015 Respiratory complexes III and IV can each bind two molecules of cytochrome c at low ionic strength.
25578497 2015 Extracellular cytochrome c as a biomarker for monitoring therapeutic efficacy and prognosis of non-small cell lung cancer patients.
25416956 2014 A proteome-scale map of the human interactome network.
25275009 2014 Activation of mitochondrial protease OMA1 by Bax and Bak promotes cytochrome c release during apoptosis.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25028650 2014 In vitro ultrastructural changes of MCF-7 for metastasise bone cancer and induction of apoptosis via mitochondrial cytochrome C released by CaCO3/Dox nanocrystals.
24329121 2014 Enhancing the peroxidase activity of cytochrome c by mutation of residue 41: implications for the peroxidase mechanism and cytochrome c release.
24326104 2014 Mutations of cytochrome c identified in patients with thrombocytopenia THC4 affect both apoptosis and cellular bioenergetics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24099549 2013 The hydrogen-peroxide-induced radical behaviour in human cytochrome c-phospholipid complexes: implications for the enhanced pro-apoptotic activity of the G41S mutant.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23443079 2012 Ginsenoside Rh2 induces human hepatoma cell apoptosisvia bax/bak triggered cytochrome C release and caspase-9/caspase-8 activation.
23334161 2013 Conformational change and human cytochrome c function: mutation of residue 41 modulates caspase activation and destabilizes Met-80 coordination.
23207240 2013 PSAP induces a unique Apaf-1 and Smac-dependent mitochondrial apoptotic pathway independent of Bcl-2 family proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23150584 2013 Human mitochondrial holocytochrome c synthase's heme binding, maturation determinants, and complex formation with cytochrome c.
23070294 2013 Versatility of non-native forms of human cytochrome c: pH and micellar concentration dependence.
22363611 2012 TNF?-induced apoptosis enabled by CCN1/CYR61: pathways of reactive oxygen species generation and cytochrome c release.
22320973 2011 Mechanisms of TRAIL and gemcitabine induction of pancreatic cancer cell apoptosis.
22192356 2012 Specific nitration of tyrosines 46 and 48 makes cytochrome c assemble a non-functional apoptosome.
22184220 2012 Label-free Raman observation of cytochrome c dynamics during apoptosis.
22157762 2012 Mitochondrial Rac1 GTPase import and electron transfer from cytochrome c are required for pulmonary fibrosis.
22102269 2011 Congenital thrombocytopenia and cytochrome C mutation: a matter of birth and death.
21869827 2012 The IAP-antagonist ARTS initiates caspase activation upstream of cytochrome C and SMAC/Diablo.
21751259 2011 Co-treatment with ginsenoside Rh2 and betulinic acid synergistically induces apoptosis in human cancer cells in association with enhanced capsase-8 activation, bax translocation, and cytochrome c release.
21712378 2011 Resveratrol induces p53-independent, X-linked inhibitor of apoptosis protein (XIAP)-mediated Bax protein oligomerization on mitochondria to initiate cytochrome c release and caspase activation.
21706253 2011 Tyrosine phosphorylation turns alkaline transition into a biologically relevant process and makes human cytochrome c behave as an anti-apoptotic switch.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21448217 2011 CSF Bcl-2 and cytochrome C temporal profiles in outcome prediction for adults with severe TBI.
21269460 2011 Initial characterization of the human central proteome.
21192676 2011 The proapoptotic G41S mutation to human cytochrome c alters the heme electronic structure and increases the electron self-exchange rate.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20671748 2011 Bcl-2 family interaction with the mitochondrial morphogenesis machinery.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20227384 Nitration of tyrosine 74 prevents human cytochrome c to play a key role in apoptosis signaling by blocking caspase-9 activation.
19895853 2009 NOA36/ZNF330 is a conserved cystein-rich protein with proapoptotic activity in human cells.
19875445 2010 Role for X-linked Inhibitor of apoptosis protein upstream of mitochondrial permeabilization.
19851871 2010 Cytochrome c-induced lymphocyte death from the outside in: inhibition by serum leucine-rich alpha-2-glycoprotein-1.
19770576 2009 Sorafenib induces preferential apoptotic killing of a drug- and radio-resistant Hep G2 cells through a mitochondria-dependent oxidative stress mechanism.
19640329 2009 Serum levels of p53 and cytochrome c in subjects with type 2 diabetes and impaired glucose tolerance.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19404857 2009 Absence of pro-apoptotic CYTOCHROME C gene mutation in common solid cancers and acute leukaemias.
19172527 2009 Absence of CYCS mutations in a large Italian cohort of patients with inherited thrombocytopenias of unknown origin.
19029908 2008 Glucose metabolism inhibits apoptosis in neurons and cancer cells by redox inactivation of cytochrome c.
18825408 2009 A novel role of serum cytochrome c as a tumor marker in patients with operable cancer.
18417609 2008 Identification of a novel protein MICS1 that is involved in maintenance of mitochondrial morphology and apoptotic release of cytochrome c.
18345000 2008 A mutation of human cytochrome c enhances the intrinsic apoptotic pathway but causes only thrombocytopenia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16934433 2006 Monomorphism of human cytochrome c.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14063298 1963 HUMAN HEART CYTOCHROME C. CHYMOTRYPTIC PEPTIDES, TRYPTIC PEPTIDES, AND THE COMPLETE AMINO ACID SEQUENCE.
13933734 1962 The amino acid sequence of human heart cytochrome c.
12909341 2003 The human genome has 49 cytochrome c pseudogenes, including a relic of a primordial gene that still functions in mouse.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12555167 2002 Apoptosis in heart failure represents programmed cell survival, not death, of cardiomyocytes and likelihood of reverse remodeling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12416732 2002 Iron toxicity and chelation therapy.
12243190 2002 Bax releases cytochrome c preferentially from a complex between porin and adenine nucleotide translocator. Hexokinase activity suppresses this effect.
12147322 2002 N-methyl-D-aspartate receptor and L-type voltage-gated Ca(2+) channel antagonists suppress the release of cytochrome c and the expression of procaspase-3 in rat hippocampus after global brain ischemia.
12101247 2002 Testis-specific cytochrome c-null mice produce functional sperm but undergo early testicular atrophy.
11839755 2002 Galectin-3 translocates to the perinuclear membranes and inhibits cytochrome c release from the mitochondria. A role for synexin in galectin-3 translocation.
11790791 2002 Cytochrome c release upon Fas receptor activation depends on translocation of full-length bid and the induction of the mitochondrial permeability transition.
11784858 2002 Hsp27 as a negative regulator of cytochrome C release.
11737208 2001 Cytochrome c/cytochrome c oxidase interaction. Direct structural evidence for conformational changes during enzyme turnover.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10980706 2000 Hsp27 negatively regulates cell death by interacting with cytochrome c.
10818086 2000 Mitochondrial translocation of protein kinase C delta in phorbol ester-induced cytochrome c release and apoptosis.
10801801 2000 Ubiquitin-mediated degradation of the proapoptotic active form of bid. A functional consequence on apoptosis induction.
10683230 2000 Evaluation of methods for the determination of mitochondrial respiratory chain enzyme activities in human skeletal muscle samples.
10622714 1999 Over-expression of Bcl-2 does not protect cells from hypericin photo-induced mitochondrial membrane depolarization, but delays subsequent events in the apoptotic pathway.
10506125 1999 Role of cytochrome c as a stimulator of alpha-synuclein aggregation in Lewy body disease.
10206961 1999 An APAF-1.cytochrome c multimeric complex is a functional apoptosome that activates procaspase-9.
10082581 1999 SAG, a novel zinc RING finger protein that protects cells from apoptosis induced by redox agents.
9922454 1999 Ordering the cytochrome c-initiated caspase cascade: hierarchical activation of caspases-2, -3, -6, -7, -8, and -10 in a caspase-9-dependent manner.
9847074 1998 Toward a complete human genome sequence.
9760250 1998 The influence of mutation at Glu44 and Glu56 of cytochrome b5 on the protein's stabilization and interaction between cytochrome c and cytochrome b5.
9615439 1998 Conformational changes in the mitochondrial channel protein, VDAC, and their functional implications.
9515723 1998 Cytochrome c in the apoptotic and antioxidant cascades.
9390557 1997 Cytochrome c and dATP-dependent formation of Apaf-1/caspase-9 complex initiates an apoptotic protease cascade.
9267021 1997 Apaf-1, a human protein homologous to C. elegans CED-4, participates in cytochrome c-dependent activation of caspase-3.
9192670 1997 Role for Bcl-xL as an inhibitor of cytosolic cytochrome C accumulation in DNA damage-induced apoptosis.
9027314 1997 Prevention of apoptosis by Bcl-2: release of cytochrome c from mitochondria blocked.
8689682 1996 Induction of apoptotic program in cell-free extracts: requirement for dATP and cytochrome c.
8206937 1994 The catalytic subunit of protein phosphatase 2A is carboxyl-methylated in vivo.
6270113 1981 Fluorescence energy transfer studies of the interaction between adrenodoxin and cytochrome c.
6262312 1981 Electrostatic interaction of cytochrome c with cytochrome c1 and cytochrome oxidase.
6251869 1980 Interaction of cytochrome c with cytochrome bc1 complex of the mitochondrial respiratory chain.
6088481 1984 Spectroscopic analysis of the interaction between cytochrome c and cytochrome c oxidase.
6087732 1984 Sedimentation equilibrium studies on the interaction between cytochrome c and cytochrome c peroxidase.
4403130 1972 Soluble cytochrome b 5 reductase from human erythrocytes.
2849112 1988 The human somatic cytochrome c gene: two classes of processed pseudogenes demarcate a period of rapid molecular evolution.
2844747 1988 Construction of a human cytochrome c gene and its functional expression in Saccharomyces cerevisiae.
2580882 1985 Immunocytochemical demonstration of cytochrome c oxidase with an immunoperoxidase method: a specific stain for mitochondria in formalin-fixed and paraffin-embedded human tissues.
2153405 1990 Interaction of cytochrome c with cytochrome c oxidase: an understanding of the high- to low-affinity transition.
1309738 1992 Cytochrome c binding affects the conformation of cytochrome a in cytochrome c oxidase.
199233 1977 Effect of modification of individual cytochrome c lysines on the reaction with cytochrome b5.