Property Summary

NCBI Gene PubMed Count 27
PubMed Score 52.28
PubTator Score 32.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.619 1.0e-04
malignant mesothelioma 1.100 5.0e-06
psoriasis 2.600 6.4e-06
pancreatic ductal adenocarcinoma liver m... -1.275 8.5e-03
non-small cell lung cancer 1.112 6.5e-16
lung cancer 1.400 2.8e-04
ovarian cancer 2.100 1.4e-04

Gene RIF (17)

PMID Text
27117663 FASL, granzyme B, and cytochrome c blood expression reflects breast cancer progression and response to therapy. (Review)
25562155 our results provide evidence that CYC1 plays an important role in OS tumorigenesis, and modulation of CYC1 may be an effective strategy to potentiate OS to apoptotic induction by TRAIL.
23910460 Mutations in CYC1 cause insulin-responsive hyperglycemia.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cytochrome c-1 (CYC1) expression by HIV-1 Vpr in Vpr transduced macrophages
21577235 HeLa cells expressing non-cleavable cytochrome c1 maintain mitochondrial morphology and functions.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20440543 Decreased electron Transport Complex IV activity is associated with ulcerative colitis.
16699948 Sensitivity of Cyt c detection in -linked immunosorbent assay is reduced in the presence of serum leucine-rich alpha-2-glycoprotein-1.
16511342 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cytochrome c-1 (CYC1) expression by HIV-1 Vpr in Vpr transduced macrophages
14966123 the Ca(2+) spike, mitochondrial Bcl-2 presensitization, and subsequent Delta psi(m) transition, Bax translocation, and ROS generation are important upstream signals for cytochrome c release upon stimulation by a Bcl-2 inhibitor.
12788227 Addition of H202 to tendon fibroblasts in vitro resulted in oxidative stress-induced apoptosis and the release of CYC1.
12750404 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cytochrome c-1 (CYC1) expression by HIV-1 Vpr in Vpr transduced macrophages
12750393 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cytochrome c-1 (CYC1) expression by HIV-1 Vpr in Vpr transduced macrophages
12096338 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cytochrome c-1 (CYC1) expression by HIV-1 Vpr in Vpr transduced macrophages
12095993 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cytochrome c-1 (CYC1) expression by HIV-1 Vpr in Vpr transduced macrophages
11181702 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cytochrome c-1 (CYC1) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVMLSALGMLAAG      1 - 70
GAGLAMALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCY     71 - 140
TEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDY    141 - 210
VFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEP    211 - 280
EHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPPK                             281 - 325
//

Text Mined References (32)

PMID Year Title
27117663 2016 Apoptosis Markers in Breast Cancer Therapy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25562155 2014 CYC1 silencing sensitizes osteosarcoma cells to TRAIL-induced apoptosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23910460 2013 Mutations in CYC1, encoding cytochrome c1 subunit of respiratory chain complex III, cause insulin-responsive hyperglycemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21577235 2012 Caspase cleavage of cytochrome c1 disrupts mitochondrial function and enhances cytochrome c release.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20440543 2010 Mitochondrial respiratory chain in the colonic mucosal of patients with ulcerative colitis.
19946888 2010 Defining the membrane proteome of NK cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16699948 2006 Serum leucine-rich alpha-2-glycoprotein-1 binds cytochrome c and inhibits antibody detection of this apoptotic marker in enzyme-linked immunosorbent assay.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15544925 2004 Oxidative modification of mitochondrial respiratory complexes in response to the stress of Trypanosoma cruzi infection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14966123 2004 Critical upstream signals of cytochrome C release induced by a novel Bcl-2 inhibitor.
12788227 2003 Involvement of cytochrome c release and caspase-3 activation in the oxidative stress-induced apoptosis in human tendon fibroblasts.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10453733 1999 A mitochondrial cytochrome b mutation but no mutations of nuclearly encoded subunits in ubiquinol cytochrome c reductase (complex III) deficiency.
8188279 1994 Assignment of the gene for the cytochrome c1 subunit of the mitochondrial cytochrome bc1 complex (CYC1) to human chromosome 8q24.3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6262312 1981 Electrostatic interaction of cytochrome c with cytochrome c1 and cytochrome oxidase.
3036122 1987 Isolation of a cDNA clone for human cytochrome c1 from a lambda gt11 expression library.
2999105 1985 Novel purification of cytochrome c1 from mitochondrial Complex III. Reconstitution of antimycin-insensitive electron transfer with the iron-sulfur protein and cytochrome c1.
2839188 1988 Assignment of the human cytochrome c1 gene to chromosome 8.
2836796 1988 Nucleotide sequence of a cDNA encoding the precursor to human cytochrome c1.
2536365 1989 Structural organization of the human mitochondrial cytochrome c1 gene.