Property Summary

NCBI Gene PubMed Count 24
PubMed Score 60.25
PubTator Score 35.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (35)

Disease log2 FC p
active ulcerative colitis 1.669 3.0e-02
acute quadriplegic myopathy 1.345 9.0e-04
adrenocortical carcinoma -1.870 3.5e-05
adult high grade glioma 1.500 2.1e-04
Astrocytoma, Pilocytic 1.300 2.5e-05
Atopic dermatitis -1.100 1.1e-02
atypical teratoid / rhabdoid tumor 2.500 5.2e-06
autosomal dominant Emery-Dreifuss muscul... 1.537 3.8e-03
Breast cancer -1.400 2.3e-03
breast carcinoma -1.700 1.0e-05
cutaneous lupus erythematosus -1.300 3.0e-03
cystic fibrosis 1.153 7.1e-05
Duchenne muscular dystrophy 1.491 5.4e-05
ductal carcinoma in situ -1.700 7.6e-04
ependymoma 1.900 1.3e-10
fascioscapulohumeral muscular dystrophy 1.147 1.8e-04
glioblastoma 1.800 9.4e-07
group 3 medulloblastoma -1.400 4.3e-03
intraductal papillary-mucinous adenoma (... -2.200 2.5e-02
intraductal papillary-mucinous carcinoma... -3.500 1.3e-02
invasive ductal carcinoma -1.174 4.9e-02
limb girdle muscular dystrophy 2A 1.229 1.7e-03
lung adenocarcinoma -1.600 9.4e-11
lung cancer -2.400 2.6e-03
lung carcinoma -2.700 1.8e-21
malignant mesothelioma -1.300 3.1e-06
medulloblastoma, large-cell -2.800 1.3e-03
non-small cell lung cancer -1.885 8.1e-25
ovarian cancer -1.100 1.6e-03
pancreatic cancer 1.200 3.0e-02
permanent atrial fibrillation -1.200 2.7e-06
pituitary cancer -2.300 1.2e-07
primary pancreatic ductal adenocarcinoma 2.156 4.0e-04
psoriasis -1.200 1.5e-02
tuberculosis 1.100 4.4e-05

Protein-protein Interaction (6)

Gene RIF (14)

AA Sequence

MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGIAIIVYR      1 - 70
LPWTWKCSKLLMKSIHAGLNAVAAILAIISVVAVFENHNVNNIANMYSLHSWVGLIAVICYLLQLLSGFS     71 - 140
VFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILV    141 - 210
FGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEA    211 - 280
GQRSTM                                                                    281 - 286
//

Text Mined References (38)

PMID Year Title