Property Summary

NCBI Gene PubMed Count 21
PubMed Score 56.24
PubTator Score 35.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (35)

Disease log2 FC p
malignant mesothelioma -1.300 3.1e-06
permanent atrial fibrillation -1.200 2.7e-06
cutaneous lupus erythematosus -1.300 3.0e-03
psoriasis -1.200 1.5e-02
ependymoma 1.900 1.3e-10
glioblastoma 3.000 2.3e-08
group 4 medulloblastoma -3.200 3.9e-08
cystic fibrosis 1.153 7.1e-05
atypical teratoid / rhabdoid tumor 2.500 5.2e-06
medulloblastoma, large-cell -2.800 1.3e-03
Duchenne muscular dystrophy 1.491 5.4e-05
autosomal dominant Emery-Dreifuss muscul... 1.537 3.8e-03
fascioscapulohumeral muscular dystrophy 1.147 1.8e-04
acute quadriplegic myopathy 1.345 9.0e-04
limb girdle muscular dystrophy 2A 1.229 1.7e-03
Atopic dermatitis -1.600 4.2e-04
adrenocortical carcinoma -2.271 1.7e-07
primary pancreatic ductal adenocarcinoma 2.156 4.0e-04
tuberculosis 2.400 5.1e-06
non-small cell lung cancer -1.885 8.1e-25
intraductal papillary-mucinous adenoma (... -2.200 2.5e-02
intraductal papillary-mucinous carcinoma... -3.500 1.3e-02
lung cancer -3.700 7.6e-07
active ulcerative colitis 1.669 3.0e-02
breast carcinoma -1.700 1.0e-05
lung adenocarcinoma -1.800 2.5e-10
pediatric high grade glioma 2.300 8.5e-08
pilocytic astrocytoma 1.300 3.2e-05
invasive ductal carcinoma -2.400 3.3e-04
Breast cancer -1.400 2.3e-03
lung carcinoma -2.700 1.8e-21
ductal carcinoma in situ -1.700 7.6e-04
ovarian cancer -3.700 1.9e-07
pituitary cancer -3.000 2.8e-08
pancreatic cancer 2.100 2.3e-03

 IMPC Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (12)

PMID Text
23012398 Letter: report mutations in CYBRD1 promoter in and possible role in iron hemostasis in patients with porphyria cutanea tarda.
22773607 Polymorphisms in CYBRD1 modulates iron phenotype in HFE p.C282Y homozygous hemochromatosis.
20587610 Observational study of gene-disease association. (HuGE Navigator)
19673882 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18492824 The results of this study confirm that Dcytb can act as a ferric reductase that stimulates iron uptake in Caco-2 cells.
18194661 Functional characterization of Cybrd1 heme groups and iron/ascorbate metabolism.
18092813 The current study concerns the recombinant expression, purification, and initial spectroscopic characterization of a recombinant form of the human ferric reductase.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17068337 Duodenal cytochrome b present in human erythrocytes may contribute to their ability to reduce extracellular monodehydroascorbate.
15338274 Observational study of gene-disease association. (HuGE Navigator)
15338274 In Africans with iron overload not related to the HFE gene, the possible involvement of the SLC40A1 and CYBRD1 genes was demonstrated for the first time.

AA Sequence

MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGIAIIVYR      1 - 70
LPWTWKCSKLLMKSIHAGLNAVAAILAIISVVAVFENHNVNNIANMYSLHSWVGLIAVICYLLQLLSGFS     71 - 140
VFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILV    141 - 210
FGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEA    211 - 280
GQRSTM                                                                    281 - 286
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23012398 2013 Iron homeostasis in porphyria cutanea tarda: mutation analysis of promoter regions of CP, CYBRD1, HAMP and SLC40A1.
22773607 2012 CYBRD1 as a modifier gene that modulates iron phenotype in HFE p.C282Y homozygous patients.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19673882 2009 A novel association between a SNP in CYBRD1 and serum ferritin levels in a cohort study of HFE hereditary haemochromatosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18492824 2008 Duodenal cytochrome B expression stimulates iron uptake by human intestinal epithelial cells.
18194661 2008 Functional characterization of human duodenal cytochrome b (Cybrd1): Redox properties in relation to iron and ascorbate metabolism.
18092813 2008 Recombinant expression and initial characterization of the putative human enteric ferric reductase Dcytb.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17087784 2006 Immunolocalization of duodenal cytochrome B: a relationship with circulating markers of iron status.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17068337 2006 Human erythrocyte membranes contain a cytochrome b561 that may be involved in extracellular ascorbate recycling.
16521312 2005 Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload.
16521311 2005 Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload.
16521301 2005 Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload.
16510471 2006 Duodenal cytochrome b: a novel ferrireductase in airway epithelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15338274 2004 Analysis of genes implicated in iron regulation in individuals presenting with primary iron overload.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14499595 2003 Stromal cell-derived receptor 2 and cytochrome b561 are functional ferric reductases.
12949720 2003 Duodenal cytochrome b and hephaestin expression in patients with iron deficiency and hemochromatosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230685 2001 An iron-regulated ferric reductase associated with the absorption of dietary iron.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.