Property Summary

NCBI Gene PubMed Count 278
PubMed Score 358.80
PubTator Score 315.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.203 4.1e-02
Barrett's esophagus 1.200 3.8e-02
esophageal adenocarcinoma 1.600 1.8e-02
cutaneous lupus erythematosus 1.700 3.2e-03
psoriasis 2.300 5.2e-05
glioblastoma 2.100 9.8e-04
osteosarcoma 1.023 1.5e-02
posterior fossa group A ependymoma 1.700 7.3e-08
periodontitis 1.500 5.0e-24
pancreatic ductal adenocarcinoma liver m... 1.551 2.1e-02
interstitial cystitis 1.400 7.7e-05
pilocytic astrocytoma 1.200 2.2e-06
subependymal giant cell astrocytoma 1.757 2.2e-02
invasive ductal carcinoma 1.154 4.3e-03
lung carcinoma -1.200 2.3e-15
ovarian cancer 1.600 1.4e-05
pancreatic cancer 1.100 4.0e-03

Protein-protein Interaction (14)

Gene RIF (299)

PMID Text
26852662 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/beta-arrestin 2/Rho A signaling pathway.
26415877 Downregulating p22phox ameliorates inflammatory response in Angiotensin II-induced oxidative stress by regulating MAPK and NF-kappaB pathways in retinal pigment cells.
26317224 increased levels of gp91phox, p47phox and p22phox likely account for the interferon-gamma mediated enhancement of dimethyl sulfoxide-induced Nox2 activity.
26244812 Data show that p22phox expression correlated with Epstein-Barr virus (EBV) and its encoded oncoprotein, latent membrane protein 1 (LMP1) expression.
26130419 C936T polymorphism of the VEGF gene and the C242T polymorphism of the p22phox gene are not correlated with diabetes mellitus type 2 and distal diabetic polyneuropathy.
26117319 TRX-1/PRX-1 levels are associated with NADPH oxidase-activity in vivo and in vitro in atherosclerosis.
25990054 the C242T polymorphism might be a protective factor against developing acute coronary syndrome in the Asian population [meta-analysis]
25888935 results suggest the evaluated NOX4 and CYBA SNPs are not direct genetic determinants of fibrosis in patients with chronic hepatitis C
25862415 A functional variant in the promoter of the CYBA gene is associated with reduced renal function and with prevalence and incidence of diabetic nephropathy and end-stage renal disease in type 1 diabetic patients.
25823784 our present analysis reinforces the involvement in ACT of the regulatory NADPH oxidase subunit RAC2 gene variant rs13058338 and, to a lesser extent of the CYBA gene variant rs4673.
25787042 The analysis of covariance revealed that CYBA risk alleles and their haplotypes, were positively correlated with clinical parameters, for example, systolic blood pressure, diastolic blood pressure and mean arterial pressure, and biochemical parameters
25697362 Data show that NADPH oxidase NOX4 and p22(phox) localize to the nuclear membrane in MV4-11 leukemia cells expressing internal tandem duplication of the FMS-like tyrosine kinase (FLT3-ITD) receptor.
25686830 CDDP entry into the nucleus was severely impaired in p22phox-overexpressing cells (P < 0.001), and cytoplasmically accumulated CDDP was co-localized with overexpressed p22phox.
25619262 p22phox C242T polymorphism may have a role in ischemic cerebrovascular disease [meta-analysis]
25599773 Although our data suggest that expression of the gene encoding p22phox is not associated with chronic inflammation in patients with ulcerative colitis, other mechanisms can affect oxidative stress in these patients
25572489 The A930G polymorphism of the p22phox gene may affect the susceptibility to ICH and certain haplotypes of the gene may be associated with a higher susceptibility to ICH.
25569182 HIV-1 Tat and cocaine treatment upregulates the expression of NADPH oxidase-p22Phox in human pulmonary arterial smooth muscle cells
25307973 The CYBA C-242T and CAT C-262T genetic polymorphisms and their epistatic interactions can be associated with ICC through mechanisms related with the role of ROS in cell proliferation and apoptosis.
25252997 A possible role of the first transmembrane domain (Trp18), and the region between the membrane and the dehydrogenase domain of NOX2 (Glu309, Ile325 and Gly389), in the binding with p22phox.
25173715 These results suggest that the recipients' p22(phox) C242T polymorphism may be a major risk factor for DGF in renal transplantation.
25095657 The mutant allele of the p22phox gene increases the risk of arterial and venous thrombosis in systemic lupus erythematosus.
24890187 These observations clarify the effects of the studied polymorphisms on glomerular filtration rate and exemplify gene-gene interactions influencing renal function.
24864467 The mutant TT genotype of the CYBA gene was significantly more common in the chronic hepatitis C patients with rapidly progressive fibrosis than in those with slowly progressive fibrosis
24573492 Frequency of the T-allele was not observed as significantly different between hypertensive and normotensive individuals. Blood pressure or the prevalence of hypertension did not vary between C242T p22PHOX genotypes.
24486703 Homocysteine-induced expression of p22(phox) is regulated by the reactive oxygen species/p38MAPK pathway and PPARdelta activation is capable of attenuating this pathway by eliminating Hcy-induced reactive oxygen species production.
24477591 In conclusion the -930A>G CYBA polymorphism is associated with CAD in the Polish population. The -930G allele carriers are particularly at risk of consequences of obesity and tobacco smoke exposure.
24415302 C242T polymorphism of p22phox gene of NADPH oxidase is a novel genetic marker associated with reduced susceptibility to AMI.
24392120 Our meta-analysis confirmed a protective effect of C242T polymorphism on CAD in Asian population and indicated that A640G polymorphism was significantly associated with decreased risk of CAD.
24349292 This meta-analysis indicates that the A930G polymorphism, but not the C242T variation, might be a protective factor for hypertension.
24345348 the A640G polymorphism may play a protective role in coronary heart disease.
24339896 p22-phox 242T allele is associated with higher blood pressure levels among subjects with higher urinary sodium exretion in an urban Brazilian population
24156725 A meta-analysis indicates that the NAD(P)H oxidase P22 phox gene 242 T allele might be associated with an increased type 2 diabetes mellitus risk.
24113386 These findings reveal a new function of p22(phox) in tumor angiogenesis and tumor growth.
24039708 The CYBA C242T polymorphism might be a risk-conferring factor on developing coronary artery disease. [Meta-analysis]
24035466 Vascular hnRNP-C expression is regulated by ROS derived from NADPH oxidases and that the effects of NADPH oxidase on vascular activation are mediated in part by protein kinase CK1alpha.
24033955 The AA genotype of rs7195830 is independently associated with lower estimated glomerular filtration rate and is significantly associated with CKD
23949976 findings showed aging is significantly associated with p22phox C242T genotypes in the Turkish population, being highest in CC, intermediate in CT and lowest in TT homozygote; results implied CC genotype may protect people from chronic inflammation and diseases and from oxidative stress
23922196 NADPH oxidase p22phox gene C242T, A640G and -A930G polymorphisms are not risk factors for knee osteoarthritis susceptibility in the Greek population.
23905423 The aim of the present study was to review the available information on the CYBA gene, function of its polymorphisms and their associations with atherosclerosis-related diseases.
23821607 The pattern of CYBA diversity is compatible with balancing natural selection, perhaps mediated by catalase-positive pathogens.
23755540 In this study, genotype and allele distributions of the C242T polymorphism in the CYBA gene, which encodes the alpha subunit ofNADPH oxidase (p22phox), were examined in the sample of long livers and in the population sample of the city of Tomsk
23701472 failed to demonstrate an association between either the -262C/T of the catalase gene promoter (rs1001179) or the C242T polymorphism of the P22phox gene (rs4673) or the 594C/T polymorphism of the glutathione peroxidase gene (rs1050450) and hypertension
23684671 p22phox gene C242T polymorphism is unrelated to the risk of ischemic stroke {REVIEW}
23576480 The contribution of the functionally relevant NADPH polymorphisms rs1883112 and rs4673 to anthracycline-related heart lesions provides a plausible explanation for their modulation of cardiotoxicity.
23409188 NADPH oxidase p22(phox) C242T polymorphism is more associated with large-artery atherosclerotic stroke than small-vessel occlusive stroke
22997914 Genetic polymorphism of p22-phox protein considered as potential predictor of severity of metabolic syndrom target organs impairment.
22995606 Common polymorphisms of the CYBA gene that encodes p22phox subunit of NADPH oxidase do not influence aortic stiffness in young, healthy individuals.
22932942 The NADPH C242T polymorphism is not associated with the degree of oxidative stress and carotid atherosclerosis in diabetic patients.
22919264 C242T (rs4673) CYBA polymorphisms did not have a different allele or genotype distribution between normal and high tension glaucoma patients.
22884975 NADPH oxidase-derived reactive oxygen species are critical to leukotriene B(4) pro-survival effect on neutrophils. This effect also relies on redox modulation of nuclear factor kappaB signaling pathway.
22808130 The data point to four strategic (87)HEES(90) amino acid residues of the S100A8 C-terminal sequence that are involved directly in the molecular interaction with cytochrome b(558) and then in the phagocyte NADPH oxidase activation.
22807997 FLT3 driven H2O2 production in acute myeloid leukemia cells is mediated by p22phox and is critical for STAT5 signalling.
22747689 In amateur runners, CYBA variants may influence both systolic and diastolic function and arterial stiffness.
22613645 The mutant genotypes of the p22phox gene 549C > T polymorphism had a significant effect on the increased risk of coronary artery disease in this studied population.
22496489 Results suggest that p22phox C242T polymorphism is associated with arterial stiffness evaluated by pulse wave velocity (PWV) in the general population.
22410402 The rs13306294 A allele is a potential factor of stenosis of coronary arteries that increases susceptibility for the extent of disease.
22396743 the C242T gene polymorphism is related to the prevalence of metabolic syndrome and smoking dose might modify this association
22357521 The rs1049255 and rs7195830 polymorphisms of the CYBA gene were associated with small artery elasticity in a Chinese population; physical activity could modify this genetic effect.
22268370 The CYBA C242T polymorphism has been associated with cardiovascular phenotypes such as hypertension and atherosclerosis
21973220 the risk alleles of CYBA and GSTP1, their haplotypes and gene-gene interactions are associated with imbalanced oxidative stress and, thereby, with high-altitude adaptation and mal-adaptation.
21962117 The functional SNPs CYBA -675 T --> A and GCLC rs17883901, probably associated with cellular redox imbalances, modulate the risk for renal disease in the studied population of type 1 diabetes patients
21884584 The T allele of the p22-phox C242T SNP is associated with higher left ventricular mass/height and increased NADPH-oxidase activity in hypertensive patients. Genetic variation within NADPH-oxidase may modulate left ventricular remodeling in hypertension.
21777168 results suggest that the CYBA A640G polymorphism may influence individual predispositions to coronary arter disease through interactions with smoking and hypercholesterolemia
21699462 The NADPH oxidase was significantly increased in BD patients, both at basal conditions and in response to fMLP stimulation.
21640156 A novel, low-resolution distance constraint in p22(phox). The medically-relevant p.Y72H polymorphism has an invariant structural motif in this region.
21624462 A polymorphism of NADPH oxidase p22 phox is associated with reduced susceptibility to acute rejection in renal allograft recipients.
21622150 The A640G CYBA polymorphism may be a marker of oxidative stress risk and may be indicative of subclinical atherosclerosis in type 2 diabetes
21282351 P22-PHOX and RAGE gene expression were higher in epicardial adipose tissue than in subcutaneous adipose tissue, whereas catalase mRNA levels were lower.
21237524 Significant positive bivariate correlation was found between glucose and malondialdehyde level as well as p22phox expression
21136016 p22-PHOX (CYBA) polymorphisms may have a role in preventing premature coronary artery disease
21118808 Up-regulation of p22(phox) represents a novel pro-survival mechanism through which growth factors and Akt inhibit apoptosis in PaCa cells.
21086617 Observational study of gene-disease association. (HuGE Navigator)
21082491 The study did not show that the C242T polymorphism of the CYBA gene is a risk factor of ischaemic stroke in children
21082491 Observational study of gene-disease association. (HuGE Navigator)
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21045268 the C242T CYBA polymorphism is associated with the development of cardiovascular disease in end stage renal disease
21045268 Observational study of gene-disease association. (HuGE Navigator)
20708598 analysis of superoxide overproduction by the D-Loop(Nox4)-Nox2 cytochrome b(558) in phagocytes
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20603655 Common genetic polymorphisms within the promoter and exonic sequences of CYBA, the gene that encodes the p22phox subunit of the NADPH oxidase, have been characterized in the context of cardiovascular diseases--{REVIEW}
20598694 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20581851 Single-locus analysis revealed that the C+640T polymorphism (rs1049255) in the 3'-UTR of CYBA and the G+243A polymorphism (rs841) in the 3'-UTR of GCH1 were independently associated with an elevated risk of CHD in a Chinese Han population
20581851 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20523355 The p22phox-dependent NADPH oxidase-driven ROS production must be important for in vivo megakaryocytopoiesis in human CD34+ cells.
20512451 CYBA +242C/T and PPARD +294T/C variants modulate risk of coronary artery disease through their associations with atherogenic serum lipid profiles.
20512451 Observational study of gene-disease association. (HuGE Navigator)
20505675 The 930A/G allele is associated with higher blood pressure in the brachial artery, as well as in the aorta, the A640G and C242T polymorphisms do not influence peripheral and central pressures in normotensives
20505675 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20495074 Loss of p22phox is associated with inflammasome activation resulting in chronic granulomatous disease.
20454568 The first quantitative characterization of the interactions made between the cytosolic regulators NOXO1 and NOXA1 and membrane-bound p22(phox), is presented.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20407811 granulomatous disease in Iran is predominantly due to mutations in p47-phox, while the number of mutations in p22-phox is roughly equal to that in gp91-phox, indicating that the genetics of CGD are ethnically variable
20406964 Observational study of gene-disease association. (HuGE Navigator)
20392440 a specific association between Nef and p22-phox, a membrane component of the NADPH oxidase complex, was found
20392440 HIV-1 Tat and cocaine treatment upregulates the expression of NADPH oxidase-p22Phox in human pulmonary arterial smooth muscle cells
20378006 C242T polymorphism of the P22PHOX subunit can influencw the cardio-pulmonary fitness in trained runners.
20375611 6 monoclonal antibodies were produced against purified cytochrome b(558).
20367952 In OSAHS group, higher levels of NADPH oxidase p22phox mRNA and percentages of NADPH oxidase p22phox positive neutrophils and macrophages were found in the morning than at pre-sleep.
20367096 242 T allele was associated with an oxidative burst [in neutrophils] in response to the challenge by two strains of Actinobacillus actinomycetemcomitans in patients with aggressive periodontitis
20367096 Observational study of gene-disease association. (HuGE Navigator)
20304964 p22(phox)-based Nox oxidases maintain HIF-2alpha protein expression through inactivation of tuberin and downstream activation of ribosomal protein S6 kinase 1/4E-BP1 pathway
20215507 CYBA 640A>G was shown to be a functional polymorphism with possible consequences for patients receiving CHO(E)P chemotherapy and might have further implications for other ROS-mediated modalities.
20215507 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20167518 All mutations and some polymorphisms identified in the CYBA gene in the autosomal forms of chronic granulomatous disease are listed. Review.
20100625 The results suggested a significant heterogeneity across ethnicities about the relationship between the T allele of p22phox gene C242T polymorphism and reduced CAD risk
20100625 Meta-analysis of gene-disease association. (HuGE Navigator)
20080081 The genotypes, 930AG+GG of CYBA associated with increased MDA concentration, decreased CAT activity and GSH concentration in patients.
20080081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20031716 Simultaneous examination with intravascular ultrasound and immunohistochemistry analyses suggests that p22phox-derived ROS is related to the coronary arterial remodeling process associated with plaque vulnerability.
19965945 results indicated that the etiology of patients with SLE is associated with NADPH oxidase p22phox gene C242T polymorphisms.
19965945 Observational study of gene-disease association. (HuGE Navigator)
19949658 Results describe a genetic analysis on 12 Korean patients from 10 unrelated families and found that all patients had an identical homozygous single-base substitution in the CYBA gene.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19853876 CYBA and APOE polymorphism showed a different distribution in the groups studied, while no differences were observed in MTHFR C677T polymorphism
19853876 Observational study of gene-disease association. (HuGE Navigator)
19689263 The C242T CYBA single nucleotide polymorphism is associated with altered NADPH oxidase activity in lymphoblastoid cells of patients with cardiovascular disease.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19574552 Poldip2 associates with p22phox to activate Nox4, leading to regulation of focal adhesion turnover and vascular smooth muscle cell migration, thus linking reactive oxygen species production and cytoskeletal remodeling.
19567155 The NADPH oxidase subunit p22phox gene polymorphism may be associated with susceptibility to OSAHS, and it may be an important candidate gene for OSAHS.
19564823 Observational study of gene-disease association. (HuGE Navigator)
19531958 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19516159 The researchers found evidence that the C242T CYBA variant influenced urinary levels of 8-iso-PGF2alpha at baseline but not aerobic exercise responses.
19516159 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19466604 The NADPH oxidase p22phox C242T polymorphism did not alter lymphocyte DNA damage or exercise performance at rest, immediately after exercise, or during recovery
19459419 Relations were found between -930A > G polymorphism of CYBA gene and predisposition to nonallergic bronchial asthma. This association exists in males and depends on the smoking status and vegetable diet.
19448608 Genotypic variants of CYBA rs4673 and GSTA1 rs3957357 were independent predictors of event free survival in diffuse large B-cell lymphoma treated with R-CHOP21
19423540 Observational study of gene-disease association. (HuGE Navigator)
19423521 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19401454 Oxidized LDL-induced expression of NOX may lead to the elevated release of reactive oxygen species, the activation of HSF1, and the enhancement of the transcription of PAI-1 gene in cultured vascular endothelial cells.
19388116 genetic variations in CYBA influence NOX2 activity; and haplotypes, rather than individual SNPs, define the effect on ROS generation.
19388116 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19292887 novel mutations of CYBA in autosomal recessive chronic granulomatous disease patients
19260521 The C242T polymorphism of p22PHOX is not associated with the incidence of gastric cancer in the Japanese population.
19260521 Observational study of gene-disease association. (HuGE Navigator)
19251588 prolonged exposure to Lipopolysaccharide or iron increases endothelial NADPH oxidase activity by increasing p22phox gene transcription and cellular levels of iron, heme, and p22phox protein
19222940 WAVE1 and p22phox expression in PBMCs increased and was associated with the disease course in children with acute lymphocytic leukemia (ALL).
19203534 People carrying the G-allele of CYBA 640A>G polymorphism showed lower p22(phox) protein amounts in granulocytes.
19203534 Observational study of gene-disease association. (HuGE Navigator)
19198108 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19151692 CYBA polymorphism modifies the association between cigarette smoking and intima-media thickness in young healthy adults
19151692 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19126404 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19102345 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19089790 Our data suggest that the p22PHOX 242T allele is associated with a reduced risk of developing a more severe intestinal metaplasia in subjects older than 60 years of age and in female subjects with H. pylori infection.
19089790 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19043982 Results describe a protective effect in carriers of the -930A/G polymorphism of the p22phox gene against insulin resistance in a population of Spanish obese adults.
19043982 Observational study of gene-disease association. (HuGE Navigator)
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18927546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18849343 analysis of distinct features of the Nox4-p22 phox complex
18801380 Physiological strain increases but pathological strain decreases endothelial cell survival and tubulogenesis, and these effects occur via the NAD(P)H subunit p22phox pathway.
18799874 The p22(phox) C242T single-nucleotide polymorphism is associated with stroke risk.
18799874 Observational study of gene-disease association. (HuGE Navigator)
18720901 Observational study of genotype prevalence. (HuGE Navigator)
18716406 study supports the hypothesis that genetic variability in the CYBA gene probably contributes to the susceptibility to bronchial asthma (or its related phenotypes) in our population.
18716406 Observational study of gene-disease association. (HuGE Navigator)
18672803 p22 phox a new candidate gene for allergic bronchial asthma
18672803 Observational study of gene-disease association. (HuGE Navigator)
18546332 mutations in CYBB, NCF1, CYBA or NCF2 may play a role in chronic granulomatous disease
18429753 Observational study of gene-disease association. (HuGE Navigator)
18422995 six different novel mutations in CYBA
18413200 Observational study of gene-disease association. (HuGE Navigator)
18398337 Observational study of gene-disease association. (HuGE Navigator)
18390927 The kinetics of p47phox activation was investigated by comparing neutrophils from diabetic and healthy subjects, and the mechanism of hyperglycemia-induced changes was studied by using neutrophil-like HL-60 cells as a model.
18327409 Suggest significant heterogeneity for a modulating role of the T allele in the C(242)T polymorphism of p22-phox for the occurrence of coronary artery disease across ethnicities, with the absence of a significant effect in Caucasians.
18327409 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18324526 Significant risk was found associated with CYBA gene variants and coronary heart disease risk.
18324526 Observational study of gene-disease association. (HuGE Navigator)
18309110 The physical interaction of AP-1 with p22(phox) gene promoter facilitates NADPHox regulation.
18239158 The 242T allele was a predictor of lower risk of recurrence of cardiovascular events in high-risk patients and was associated with reduced systemic oxidative stress.
18239158 Observational study of gene-disease association. (HuGE Navigator)
18158642 Regulation of NADPH oxidase by NF-kB may represent a possible mechanism whereby pro-inflammatory factors induce oxidative stress in atherosclerosis, hypertension, diabetes, stroke or heart failure.
18077487 Glucosamine sulfate downp-regulated expression of p22-phox protein in human osteoarthritis chondrocytes.
18004884 the cytosolic regulatory subunit p47phox modulates the conformation of Cyt b (in addition to serving as an adapter protein) during oxidase activation.
17996248 Describe efficient method for generating purified, functionally-reconstituted Cyt b.
17880563 Observational study of gene-disease association. (HuGE Navigator)
17880563 The p22phox C242T polymorphism may have a protective effect against cardioembolic infarction in ischemic stroke.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17684477 Expression of CYBA 640A>G is consistently associated with superoxide production in granulocytes of healthy Caucasian volunteers.
17684442 study clearly demonstrates that NAD(P)H oxidase-derived reactive oxygen species (ROS) plays a significant role in the development of atherosclerosis
17627182 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17627182 The 242T allele interacts with cigarette smoking and hypercholesterolemia to increase the risk of CAD; this risk is probably associated with the cumulative/synergistic effect of the 242T allele and both the traditional risk factors.
17620958 Observational study of gene-disease association. (HuGE Navigator)
17620958 CYBA polymorphism may be a novel genetic marker associated with essential hypertension
17617024 Observational study of gene-disease association. (HuGE Navigator)
17565201 Genetic variation in CYBA is not a risk factor for small vessel cerebrovascular disease.
17563559 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17563559 The C242T polymorphism of the CYBA gene seems to be related to endothelial function in a population-based sample of young healthy Finnish adults.
17445342 Observational study of gene-disease association. (HuGE Navigator)
17445342 patients with tetralogy of Fallot having the CC genotype for the p22phox gene may be at a higher state of oxidative stress than T allele carriers
17383305 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17383305 P22(phox) genotypes are significantly associated with coronary heart disease risk in a Chinese population and suggest potential interactions among smoking, P22(phox) genotypes, and vitamin E in relation to coronary heart disease risk
17337886 Associations between the CYBA 242C/T and the MPO -463G/A polymorphisms, oxidative stress and cardiovascular disease in chronic kidney disease patients.
17337886 Observational study of gene-disease association. (HuGE Navigator)
17336700 Potential candidate genes in these regions that have been implicated in diabetic nephropathy and/or renal damage in models of hypertension include CYBA (or P22PHOX) (16q24), NOX1 (10q22), and NOX3 (6q25.1-q26).
17314996 Observational study of gene-disease association. (HuGE Navigator)
17314996 results provide no support to the hypothesis that p22-phox -930A/G polymorphism in involved in cardiac/renal injury induced by hypertension
17307262 Observational study of gene-disease association. (HuGE Navigator)
17307262 An association between the p22(phox) C242T polymorphism and vascular aging might be mediated by the increase of oxidative stress.
17227953 analysis of the two potential cytochrome b558 activation states
17200123 VHL protein exerts its tumor suppressor action, at least partially, via inhibition of p22phox-based Nox4/Nox1 NADPH oxidase-dependent reactive oxygen species generation
17151330 Observational study of gene-disease association. (HuGE Navigator)
17149600 Observational study of gene-disease association. (HuGE Navigator)
17140397 Roles for p22phox at several distinct points in the maturation and assembly of a functionally competent Nox3 in the plasma membrane.
17015440 analysis of the integral membrane protein flavocytochrome b(558) by mass spectrometry
16998253 Observational study of gene-disease association. (HuGE Navigator)
16923427 Observational study of gene-disease association. (HuGE Navigator)
16923427 In contrast to study subjects with p22phox CC genotype, the T allele (TT + TC genotypes) is found to be protective against development of coronary artery disease, despite exposure to risk factors related to excessive NADPH-dependent superoxide production.
16922713 Observational study of gene-disease association. (HuGE Navigator)
16899095 Observational study of gene-disease association. (HuGE Navigator)
16895900 analysis of the p22phox subunit of flavocytochrome b558: identification of regions critical for gp91phox maturation and NADPH oxidase activity
16794479 Observational study of gene-disease association. (HuGE Navigator)
16788250 Observational study of gene-disease association. (HuGE Navigator)
16788250 These results support the increased risk of developing early coronary artery disease and of having rapid progression of coronary stenosis in subjects carrying the C242T nucleotide transition among the Italian population.
16754784 The results from this study reveal that cannabidiol, acting through CB2 and regulation of Nox4 and p22(phox) expression, may be a novel and highly selective treatment for leukemia.
16738684 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16608528 Observational study of gene-disease association. (HuGE Navigator)
16546843 In EH p22(phox) and PAI-1 mRNA and protein level was increased compared with C. In EH + D, doxazosin reduced p22(phox) and PAI-1 gene and protein expression, which was similar to that of C.
16543247 Observational study of gene-disease association. (HuGE Navigator)
16460309 Pro152, Pro156 & Arg158 in the p22phox PRR are indispensable for interaction with p47phox. A region C-terminal to the PRR of p22phox (AA161-164), in an a-helical conformation, aids in full oxidase activation via the association with p47phox SH3.
16358232 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16358232 the CT+TT genotypes were independently associated with a higher risk of having overt nephropathy among smokers [odds ratio (OR)=6.76, 95% confidence interval (95% CI) 1.83-25.02].
16330681 Observational study of gene-disease association. (HuGE Navigator)
16326715 the C-terminal alpha-helical region of the p22phox peptide increases the binding affinity for the tandem SH3 domains of p47phox more than 10-fold
16308493 Observational study of gene-disease association. (HuGE Navigator)
16293794 Increased expression and activity of NAD(P)H oxidase subunits and xanthine oxidase, in part mediated through angiotensin II and PKC-dependent pathways, are important mechanisms underlying increased oxidative stress in human coronary artery disease
16215641 Observational study of gene-disease association. (HuGE Navigator)
16215641 We identified a risk haplotype for nondiabetic end-stage renal disease in the CYBA gene using haplotype analysis.
16115038 the p22(phox) gene has a role in hypertension [review]
16110781 Observational study of gene-disease association. (HuGE Navigator)
16076760 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16002772 Observational study of gene-environment interaction. (HuGE Navigator)
16002772 p22phox polymorphisms, especially A640G, were associated with differential changes in systemic oxidative stress with aerobic exercise training
15994299 Both regulatory subunit binding-dependent and -independent functions of p22(phox) are implicated in regulating reactive oxygen species production by NADPH oxidase (Nox) subunits
15936011 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15927447 The Nox4 requires p22phox for ROS generation and mutational analysis revealed structural requirements affecting expression of the p22phox protein and Nox activity.
15865106 Observational study of gene-disease association. (HuGE Navigator)
15838728 Observational study of gene-disease association. (HuGE Navigator)
15824103 Nox3 functions together with p22(phox) as an enzyme constitutively producing superoxide
15683718 These findings suggest a positive feedback mechanism whereby reactive oxygen species (ROS), possibly generated by the NADPH oxidase, lead to elevated levels of p22phox and, thus, sustained ROS generation as is observed in endothelial dysfunction.
15671602 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15671602 The significance of the G(-930)A polymorphism of CYBA in the pathogenesis of hypertension was confirmed; significant effects of the genotype on BP status were observed in the male, but not the female, population
15538122 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15530459 Observational study of gene-disease association. (HuGE Navigator)
15461271 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15322091 p22phox directly interacts with Nox1 and Nox4, to form an superoxide-generating NADPH oxidase.
15322037 significantly reduced at the Anaplasma phagocytophilum phagosome
15256399 NAD(P)H oxidase activity is associated with increased protein levels of p22phox, p47phox, and p67phox, and increased p22phox and nox2 (gp91phox) mRNA expression.
15255799 Observational study of gene-disease association. (HuGE Navigator)
15219943 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15210651 Observational study of gene-disease association. (HuGE Navigator)
15210651 Hypertensive subjects carrying the GG genotype of the p22phox -930A/G polymorphism are highly exposed to NADPH oxidase-mediated oxidative stress.
15210651 Human p22phox (CYBA) -930A/G polymorphism associates with increased p22phox expression and NADPH oxidase activity in phagocytes of hypertensive patients.
15193812 Observational study of gene-disease association. (HuGE Navigator)
15193812 No assosication between p22-phox polymorphism and coronary disease in a low-risk Spanish population
15186954 Observational study of gene-disease association. (HuGE Navigator)
15172469 Observational study of gene-disease association. (HuGE Navigator)
15167446 Observational study of gene-disease association. (HuGE Navigator)
15135268 Observational study of gene-disease association. (HuGE Navigator)
15102859 Binding of FAD to cytochrome b558 is facilitated during activation of the phagocyte NADPH oxidase
15078863 Observational study of gene-disease association. (HuGE Navigator)
15078863 Superoxide production was significantly reduced by the C242T , but not the A640G or the -930A/G, polymorphism. Since p22phox exists in both the neutrophil & vessel wall, vascular oxidative stress is likely diminished in individuals with this polymorphism.
14968555 Observational study of gene-disease association. (HuGE Navigator)
14747204 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14747204 NADPH p22phox C242T polymorphisms may be useful in identifying the risk for developing diabetic nephropathy in type 2 diabetic patients.
14679084 Observational study of gene-disease association. (HuGE Navigator)
14652666 findings demonstrate that activator protein-1 activation in human smooth muscle cells in response to angiotensin II and platelet-derived growth factor-AA is mediated via generation of p22phox-dependent reactive oxygen species
14578247 Observational study of gene-disease association. (HuGE Navigator)
14578247 highly significant increase in the frequency of the T/T242 genotype in patients with nephropathy compared with those with retinopathy alone or no microvascular disease after 20 years' diabetes duration
12927691 Observational study of gene-disease association. (HuGE Navigator)
12927691 results suggest that the CYBA C242T polymorphism is involved in NAD(P)H oxidase activity and affects oxidation of lipoproteins by altering the redox state in the vasculature
12772776 adenosine pretreatment of fMLF-stimulated neutrophils results in decreased plasma membrane/secretory granule content of the flavocytochrome b components p22phox and gp91phox of the NADPH oxidase, which correlates with inhibition of ROS production
12729892 Identification of a new p22(phox)polymorphism associated with hypertension.
12697486 Observational study of genotype prevalence. (HuGE Navigator)
12679469 decompensated type 2 diabetes is associated with increased NADPH oxidase subunit p22(phox) and hemeoxygenase-1 gene expressions in circulating monocytes
12639216 Observational study of gene-disease association. (HuGE Navigator)
12547880 Observational study of gene-disease association. (HuGE Navigator)
12547880 C242T mutation in p22 phox gene is associated with progression of asymptomatic atherosclerosis in type 2 diabetes and is also associated with insulin resistance in nondiabetic subjects.
12514663 Observational study of gene-disease association. (HuGE Navigator)
12482831 In nonatherosclerotic aortic intima, the expression of p22phox by intimal smooth muscle cells is low; aortic fatty streaks contain higher levels of p22phox peptides, mostly localized in macrophages.
12446192 Observational study of gene-disease association. (HuGE Navigator)
12230880 Observational study of gene-disease association. (HuGE Navigator)
12230880 Data show that the A640G and the C242T polymorphisms of p22(phox)-based NAD(P)H oxidase were not associated with severity of coronary artery disease and endothelial function.
12226552 Observational study of gene-disease association. (HuGE Navigator)
12147803 Observational study of gene-disease association. (HuGE Navigator)
12147803 no association between a genetic variant and the incidence and progression of IgA nephropathy
12073015 A novel and unusual case of chronic granulomatous disease in a child with a homozygous 36-bp deletion in the CYBA gene (A22(0)) leading to the activation of a cryptic splice site in intron 4.
12042318 mutagenesis of histidine 94 is not required for flavocytochrome b558 function
11940577 Tumor necrosis factor-alpha increases airway smooth muscle oxidants production through a NADPH oxidase-like system to enhance myosin light chain phosphorylation and contractility.
11910303 Increased free radical production in hypertension due to increased expression of the NADPH oxidase subunit p22(phox) in lymphoblast cell lines.
11893732 p22(phox), gp91(phox), p47(phox), p67(phox), and p40(phox) existed as a functional complex in the cytoskeletal fraction.
11854221 Anaplasma phagocytophila causes a change in p22phox.
11530961 Observational study of gene-disease association. (HuGE Navigator)
11133215 Observational study of gene-disease association. (HuGE Navigator)
11023926 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRKKGSTMERWGQ      1 - 70
KYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRE     71 - 140
RPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV                   141 - 195
//

Text Mined References (285)

PMID Year Title
26852662 2016 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/?-arrestin 2/Rho A signaling pathway.
26415877 2015 Downregulating p22phox ameliorates inflammatory response in Angiotensin II-induced oxidative stress by regulating MAPK and NF-?B pathways in ARPE-19 cells.
26317224 2015 INF-? Enhances Nox2 Activity by Upregulating phox Proteins When Applied to Differentiating PLB-985 Cells but Does Not Induce Nox2 Activity by Itself.
26244812 2015 LMP1 Increases Expression of NADPH Oxidase (NOX) and Its Regulatory Subunit p22 in NP69 Nasopharyngeal Cells and Makes Them Sensitive to a Treatment by a NOX Inhibitor.
26130419 2015 Association study of C936T polymorphism of the VEGF gene and the C242T polymorphism of the p22phox gene with diabetes mellitus type 2 and distal diabetic polyneuropathy.
26117319 2015 Thioredoxin-1/peroxiredoxin-1 as sensors of oxidative stress mediated by NADPH oxidase activity in atherosclerosis.
25990054 2015 Meta-analysis of C242T polymorphism in CYBA genes: risk of acute coronary syndrome is lower in Asians but not in Caucasians.
25888935 2015 Association of a variant in the regulatory region of NADPH oxidase 4 gene and metabolic syndrome in patients with chronic hepatitis C.
25862415 2015 Allelic variations in the CYBA gene of NADPH oxidase and risk of kidney complications in patients with type 1 diabetes.
25823784 2015 Association of NADPH oxidase polymorphisms with anthracycline-induced cardiotoxicity in the RICOVER-60 trial of patients with aggressive CD20(+) B-cell lymphoma.
25787042 2015 CYBA (p22phox) variants associate with blood pressure and oxidative stress markers in hypertension: a replication study in populations of diverse altitudes.
25697362 2015 NADPH oxidase-generated hydrogen peroxide induces DNA damage in mutant FLT3-expressing leukemia cells.
25686830 2015 p22phox confers resistance to cisplatin, by blocking its entry into the nucleus.
25619262 2015 NADPH oxidase p22phox C242T polymorphism and ischemic cerebrovascular disease: an updated meta-analysis.
25599773 2014 NADPH oxidase p22phox gene expression in ulcerative colitis.
25572489 2015 Association between the nicotinamide adenine dinucleotide phosphate oxidase p22phox gene -A930G polymorphism and intracerebral hemorrhage.
25307973 2015 The role of CYBA (p22phox) and catalase genetic polymorphisms and their possible epistatic interaction in cervical cancer.
25252997 2014 Identification of NOX2 regions for normal biosynthesis of cytochrome b558 in phagocytes highlighting essential residues for p22phox binding.
25173715 2015 Investigation of association between donors' and recipients' NADPH oxidase p22(phox) C242T polymorphism and acute rejection, delayed graft function and blood pressure in renal allograft recipients.
25095657 2014 [Prognostic value of allelic variants affecting the hemostatic system in the development of antiphospholipid syndrome and kidney lesion in patients with systemic lupus erythematosus].
24890187 2014 Additive effect of polymorphisms in the ?2 -adrenoceptor and NADPH oxidase p22 phox genes contributes to the loss of estimated glomerular filtration rate in Chinese.
24864467 2014 [Endothelial dysfunction gene polymorphisms and the rate of liver fibrosis in chronic hepatitis C].
24647736 2014 Multiple nonglycemic genomic loci are newly associated with blood level of glycated hemoglobin in East Asians.
24573492 2014 C242T polymorphism of the NADPH oxidase p22PHOX gene and its association with endothelial dysfunction in asymptomatic individuals with essential systemic hypertension.
24486703 2014 PPAR? activation inhibits homocysteine-induced p22(phox) expression in EA.hy926 cells through reactive oxygen species/p38MAPK pathway.
24477591 2014 The -930A>G polymorphism of the CYBA gene is associated with premature coronary artery disease. A case-control study and gene-risk factors interactions.
24415302 2014 C242T polymorphism of NADPH oxidase p22phox gene reduces the risk of coronary artery disease in a random sample of Egyptian population.
24392120 2014 Polymorphisms of C242T and A640G in CYBA gene and the risk of coronary artery disease: a meta-analysis.
24349292 2013 The A930G polymorphism ofP22phox (CYBA) gene but not C242T variation is associated with hypertension: a meta-analysis.
24345348 2014 The A640G polymorphism in the NAD(P)H oxidase p22phox gene (CYBA) is associated with risk reduction of coronary heart disease: a meta-analysis.
24339896 2013 Influence of the C242T polymorphism of the p22-phox gene (CYBA) on the interaction between urinary sodium excretion and blood pressure in an urban Brazilian population.
24156725 2014 Association of the C242T polymorphism in the NAD(P)H oxidase P22 phox gene with type 2 diabetes mellitus risk: a meta-analysis.
24113386 2013 NADPH oxidase subunit p22(phox)-mediated reactive oxygen species contribute to angiogenesis and tumor growth through AKT and ERK1/2 signaling pathways in prostate cancer.
24039708 2013 Relationship of the p22phox (CYBA) gene polymorphism C242T with risk of coronary artery disease: a meta-analysis.
24035466 Altered vascular activation due to deficiency of the NADPH oxidase component p22phox.
24033955 2013 Association of CYBA rs7195830 polymorphism with estimated glomerular filtration rate in an adult Han sample from Jiangsu province, China.
23957209 2013 Phosphorylation of Noxo1 at threonine 341 regulates its interaction with Noxa1 and the superoxide-producing activity of Nox1.
23949976 2013 An association between polymorphism of the NADH/NADPH oxidase p22phox (phagocyte oxidase) subunit and aging in Turkish population.
23922196 2013 Association of NADPH oxidase p22phox gene C242T, A640G and -930A/G polymorphisms with primary knee osteoarthritis in the Greek population.
23910690 2013 Clinical, functional, and genetic characterization of chronic granulomatous disease in 89 Turkish patients.
23905423 2013 [The p22phox protein and the CYBA gene. Their function and associations with atherosclerosis-related diseases].
23821607 2013 Evolutionary dynamics of the human NADPH oxidase genes CYBB, CYBA, NCF2, and NCF4: functional implications.
23755540 2013 [Association between 242C > T polymorphism of NADPH oxidase p22phox gene (CYBA) and longevity in Russian population].
23701472 2014 Association of the -262C/T polymorphism in the catalase gene promoter and the C242T polymorphism of the NADPH oxidase P22phox gene with essential arterial hypertension in patients with diabetes mellitus type 2.
23684671 2013 Association between the C242T polymorphism of p22phox gene and ischemic stroke: a meta-analysis.
23576480 2013 Association of anthracycline-related cardiac histological lesions with NADPH oxidase functional polymorphisms.
23409188 2013 Association between NADPH oxidase p22(phox) C242T polymorphism and ischemic cerebrovascular disease: a meta-analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22997914 2012 [Remodeling of the cardiovascular system and development of chronic kidney disease in patients with metabolic syndrome and obesity: role of eNOS, subunit p22-phox of NADPH-oxidase and MTHFR genes].
22995606 Common single nucleotide polymorphisms of the p22phox NADPH oxidase subunit do not influence aortic stiffness in young, healthy adults.
22932942 2012 Association of the C242T polymorphism in the NADPH oxidase p22 phox gene with carotid atherosclerosis in Slovenian patients with type 2 diabetes.
22919264 2012 No difference in genotype frequencies of polymorphisms of the nitric oxide pathway between Caucasian normal and high tension glaucoma patients.
22884975 2012 Leukotriene B(4) inhibits neutrophil apoptosis via NADPH oxidase activity: redox control of NF-?B pathway and mitochondrial stability.
22808130 2012 Molecular interface of S100A8 with cytochrome b558 and NADPH oxidase activation.
22807997 2012 H2O2 production downstream of FLT3 is mediated by p22phox in the endoplasmic reticulum and is required for STAT5 signalling.
22747689 2012 NAD(P)H oxidase p22(phox) polymorphism and cardiovascular function in amateur runners.
22613645 2012 Association of nicotinamide adenine dinucleotide phosphate oxidase p22phox gene 549C>T polymorphism with coronary artery disease.
22496489 2012 Association between the C242T polymorphism in the p22phox gene with arterial stiffness in the Brazilian population.
22423966 2012 Autophagy protein Rubicon mediates phagocytic NADPH oxidase activation in response to microbial infection or TLR stimulation.
22410402 2012 Association between rs4673 (C/T) and rs13306294 (A/G) haplotypes of NAD(P)H oxidase p22phox gene and severity of stenosis in coronary arteries.
22396743 2012 Smoking dose modifies the association between C242T polymorphism and prevalence of metabolic syndrome in a Chinese population.
22357521 2012 Physical activity modifies the association between CYBA gene polymorphisms and small artery elasticity in a Chinese population.
22268370 2012 CYBA C242T polymorphism is associated with obesity and diabetes mellitus in Brazilian hypertensive patients.
21973220 2012 CYBA and GSTP1 variants associate with oxidative stress under hypobaric hypoxia as observed in high-altitude pulmonary oedema.
21962117 2011 Association of genetic variants in the promoter region of genes encoding p22phox (CYBA) and glutamate cysteine ligase catalytic subunit (GCLC) and renal disease in patients with type 1 diabetes mellitus.
21884584 2011 The C242T polymorphism of the p22-phox gene (CYBA) is associated with higher left ventricular mass in Brazilian hypertensive patients.
21777168 2011 The CYBA gene A640G polymorphism influences predispositions to coronary artery disease through interactions with cigarette smoking and hypercholesterolemia.
21699462 2012 Oxidases and oxygenases in regulation of neutrophil redox pathways in Behçet's disease patients.
21640156 2011 Invariant local conformation in p22phox p.Y72H polymorphisms suggested by mass spectral analysis of crosslinked human neutrophil flavocytochrome b.
21624462 2011 A polymorphism of NADPH oxidase p22 phox is associated with reduced susceptibility to acute rejection in renal allograft recipients.
21622150 2011 The A640G CYBA polymorphism associates with subclinical atherosclerosis in diabetes.
21282351 2011 Receptor for advanced glycation end-products expression in subcutaneous adipose tissue is related to coronary artery disease.
21237524 2011 Augmented NADPH oxidase activity and p22phox expression in monocytes underlie oxidative stress of patients with type 2 diabetes mellitus.
21136016 2011 The effect of p22-PHOX (CYBA) polymorphisms on premature coronary artery disease (? 40 years of age).
21118808 2011 NADPH oxidase activation in pancreatic cancer cells is mediated through Akt-dependent up-regulation of p22phox.
21086617 2010 [Influence of genetic factors on the development of target organ lesions in relation to age in diagnosis of arterial hypertension].
21082491 The C242T polymorphism of the gene encoding cytochrome b-245 alpha is not associated with paediatric ischaemic stroke: family-based and case-control study.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21045268 2010 Relation between development of cardiovascular disease and the C242T CYBA polymorphism of the NADPH oxidase in ESRD patients.
20708598 2011 Characterization of superoxide overproduction by the D-Loop(Nox4)-Nox2 cytochrome b(558) in phagocytes-Differential sensitivity to calcium and phosphorylation events.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20603655 2010 CYBA gene variants as biomarkers for coronary artery disease.
20598694 2010 Accumulation of gene polymorphisms related to oxidative stress is associated with myocardial infarction in Japanese type 2 diabetic patients.
20581851 2010 Exploring epistatic relationships of NO biosynthesis pathway genes in susceptibility to CHD.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20523355 2010 p22phox-dependent NADPH oxidase activity is required for megakaryocytic differentiation.
20512451 2010 Association of the CYBA, PPARGC1A, PPARG3, and PPARD gene variants with coronary artery disease and metabolic risk factors of coronary atherosclerosis in a Russian population.
20505675 2010 The effect of p22(phox) -930A/G, A640G and C242T polymorphisms of NADPH oxidase on peripheral and central pressures in healthy, normotensive individuals.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20495074 2010 Inflammasome activation in NADPH oxidase defective mononuclear phagocytes from patients with chronic granulomatous disease.
20454568 2010 Regulation of NOXO1 activity through reversible interactions with p22 and NOXA1.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20407811 2010 Molecular basis of autosomal recessive chronic granulomatous disease in iran.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20392440 2010 HIV-1 Nef associates with p22-phox, a component of the NADPH oxidase protein complex.
20378006 NAD(P)H oxidase and pro-inflammatory response during maximal exercise: role of C242T polymorphism of the P22PHOX subunit.
20375611 2009 New p22-phox monoclonal antibodies: identification of a conformational probe for cytochrome b 558.
20367952 2010 [Nicotinamide-adenine dinucleotide phosphate oxidase p22phox expression in induced sputum cells for patients with obstructive sleep apnea hypopnea syndrome].
20367096 2010 Genetic variants associated with neutrophil function in aggressive periodontitis and healthy controls.
20304964 2010 The NADPH oxidase subunit p22phox inhibits the function of the tumor suppressor protein tuberin.
20215507 2010 A functional polymorphism in the NAD(P)H oxidase subunit CYBA is related to gene expression, enzyme activity, and outcome in non-Hodgkin lymphoma.
20167518 2010 Hematologically important mutations: the autosomal recessive forms of chronic granulomatous disease (second update).
20100625 2010 Association of p22phox gene C242T polymorphism with coronary artery disease: a meta-analysis.
20080081 2010 CYP1A1, CYP1A2 and CYBA gene polymorphisms associated with oxidative stress in COPD.
20031716 2009 Impact of NAD(P)H oxidase-derived reactive oxygen species on coronary arterial remodeling: a comparative intravascular ultrasound and histochemical analysis of atherosclerotic lesions.
19965945 2010 Endothelial nitric oxide synthase and nicotinamide adenosine dinucleotide phosphate oxidase p22phox gene (C242T) polymorphisms and systemic lupus erythematosus in a Chinese Population.
19949658 2009 Genetic analysis of 10 unrelated Korean families with p22-phox-deficient chronic granulomatous disease: an unusually identical mutation of the CYBA gene on Jeju Island, Korea.
19948736 2010 Phosphorylation of p22phox on threonine 147 enhances NADPH oxidase activity by promoting p47phox binding.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19853876 2009 Genotype of the CYBA promoter -930A/G, polymorphism C677T of the MTHFR and APOE genotype in patients with hypertensive disorders of pregnancy: an observational study.
19689263 2009 The C242T CYBA polymorphism as a major determinant of NADPH oxidase activity in patients with cardiovascular disease.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19574552 2009 Poldip2, a novel regulator of Nox4 and cytoskeletal integrity in vascular smooth muscle cells.
19567155 2009 Relationship between reduced nicotinamide adenine dinucleotide phosphate oxidase subunit p22phox gene polymorphism and obstructive sleep apnea-hypopnea syndrome in the Chinese Han population.
19564823 2009 Influence of genetic polymorphisms in oxidative stress related genes and smoking on plasma MDA-LDL, soluble CD40 ligand, E-selectin and soluble ICAM1 levels in patients with coronary artery disease.
19531958 2009 A genetic variant of the p22PHOX component of NADPH oxidase C242T is associated with reduced risk of functional dyspepsia in Helicobacter pylori-infected Japanese individuals.
19516159 2009 Exercise training, NADPH oxidase p22phox gene polymorphisms, and hypertension.
19466604 2009 Effects of the NADPH oxidase p22phox C242T polymorphism on endurance exercise performance and oxidative DNA damage in response to aerobic exercise training.
19459419 2009 [Polymorphism -930A > G of the cytochrome b gene is a novel genetic marker of predisposition to bronchial asthma].
19448608 2009 Analysis of the host pharmacogenetic background for prediction of outcome and toxicity in diffuse large B-cell lymphoma treated with R-CHOP21.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19423521 2009 Genetic polymorphisms in nitric oxide synthase genes modify the relationship between vegetable and fruit intake and risk of non-Hodgkin lymphoma.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19401454 2009 Involvement of NADPH oxidase in oxidized LDL-induced upregulation of heat shock factor-1 and plasminogen activator inhibitor-1 in vascular endothelial cells.
19388116 2009 Three common polymorphisms in the CYBA gene form a haplotype associated with decreased ROS generation.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19292887 2009 Six different CYBA mutations including three novel mutations in ten families from Turkey, resulting in autosomal recessive chronic granulomatous disease.
19260521 Genetic variant of the p22PHOX component of NADPH oxidase C242T and the incidence of gastric cancer in Japan.
19251588 2009 Prolonged exposure to LPS increases iron, heme, and p22phox levels and NADPH oxidase activity in human aortic endothelial cells: inhibition by desferrioxamine.
19222940 2009 [Expression of WAVE1 and p22phox in children with acute lymphocytic leukemia and the relationship of WAVE1 with oxidative stress].
19203534 2009 Activity of NAD(P)H oxidase in relation to genotypes: comprehensive genetic mapping of single nucleotide polymorphisms (SNPs) in the p22(phox) subunit.
19198108 2008 [Molecular epidemiology of cerebrovascular diseases; the Hisayama study and the Fukuoka Stroke Registry (FSR)].
19151692 2009 The association between cigarette smoking and carotid intima-media thickness is influenced by the -930A/G CYBA gene polymorphism: the Cardiovascular Risk in Young Finns Study.
19126404 2009 Combined effect of oxidative stress-related gene polymorphisms on atherosclerosis.
19102345 No association between a genetic variant of the p22PHOX component of NADPH oxidase C242T and ulcerative colitis.
19089790 2009 Association of polymorphism of the p22PHOX component of NADPH oxidase in gastroduodenal diseases in Japan.
19043982 2008 G allele of the -930A>G polymorphism of the CYBA gene is associated with insulin resistance in obese subjects.
19012493 2009 Common variants in immune and DNA repair genes and risk for human papillomavirus persistence and progression to cervical cancer.
18927546 2008 Lp(a) and risk of recurrent cardiac events in obese postinfarction patients.
18849343 2008 Mutational analysis reveals distinct features of the Nox4-p22 phox complex.
18801380 2009 Effects of cyclic strain on endothelial cell apoptosis and tubulogenesis are dependent on ROS production via NAD(P)H subunit p22phox.
18799874 2008 The C242T polymorphism of the NAD(P)H oxidase p22phox subunit is associated with an enhanced risk for cerebrovascular disease at a young age.
18720901 2008 Genetic profiling of genes from the oxidative stress pathway among North and South Indians.
18716406 2009 Haplotype analysis of the NADPH oxidase p22 phox gene in patients with bronchial asthma.
18672803 2008 [Association of C242T and A640G polymorphisms in the gene for p22phox subunit of NADPH oxidase with the risk of bronchial asthma: a pilot study].
18546332 2008 Molecular epidemiology of chronic granulomatous disease in a series of 80 kindreds: identification of 31 novel mutations.
18429753 2008 [Influence of polymorphism's of endothelial nitric oxide synthase gene and polymorphism of NADPH oxidase gene on development of complications of arterial hypertension].
18422995 2008 Characterization of six novel mutations in CYBA: the gene causing autosomal recessive chronic granulomatous disease.
18413200 Oxidative stress pathway genes and chronic renal insufficiency in Asian Indians with Type 2 diabetes.
18398337 2008 Vascular stiffness is related to superoxide generation in the vessel wall.
18390927 2008 Priming of neutrophil oxidative burst in diabetes requires preassembly of the NADPH oxidase.
18327409 2008 The C242T polymorphism of the p22phox component of NAD(P)H oxidase and vascular risk. Two case-control studies and a meta-analysis.
18324526 2008 Insight into the role of CYBA A640G and C242T gene variants and coronary heart disease risk. A case-control study.
18309110 2008 AP-1-dependent transcriptional regulation of NADPH oxidase in human aortic smooth muscle cells: role of p22phox subunit.
18239158 2008 C242T polymorphism of NADPH oxidase p22phox and recurrence of cardiovascular events in coronary artery disease.
18158642 Regulation of NADPH oxidase subunit p22(phox) by NF-kB in human aortic smooth muscle cells.
18077487 2008 Influence of glucosamine sulphate on oxidative stress in human osteoarthritic chondrocytes: effects on HO-1, p22(Phox) and iNOS expression.
18004884 2007 Characterization of surface structure and p47phox SH3 domain-mediated conformational changes for human neutrophil flavocytochrome b.
17996248 2008 Single-step immunoaffinity purification and functional reconstitution of human phagocyte flavocytochrome b.
17880563 2007 NAD(P)H oxidase p22phox C242T polymorphism and ischemic stroke in Japan: the Fukuoka Stroke Registry and the Hisayama study.
17803994 2007 p40phox as an alternative organizer to p47phox in Nox2 activation: a new mechanism involving an interaction with p22phox.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17684477 2008 Genetic polymorphisms of NAD(P)H oxidase: variation in subunit expression and enzyme activity.
17684442 2007 Relationship between coronary plaque formation and NAD(P)H oxidase-derived reactive oxygen species - comparison of intravascular ultrasound finding of atherosclerotic lesions with histochemical characteristics-.
17627182 2007 The 242T variant of the CYBA gene polymorphism increases the risk of coronary artery disease associated with cigarette smoking and hypercholesterolemia.
17620958 2007 A novel CYBA variant, the -675A/T polymorphism, is associated with essential hypertension.
17617024 2007 A1166C polymorphism of the angiotensin AT1 receptor (AT1R) gene alters endothelial response to statin treatment.
17565201 2007 NADPH oxidase polymorphisms in cerebral small vessel disease.
17563559 2007 CYBA C242T gene polymorphism and flow-mediated vasodilation in a population of young adults: the Cardiovascular Risk in Young Finns Study.
17445342 2007 Polymorphism C242T of the gene of the p22phox subunit for nicotinamide adenine dinucleotide phosphate oxidase, and erythrocytic antioxidant enzymes, in patients with tetralogy of Fallot.
17383305 2007 Associations of polymorphism of P22(phox) C242T, plasma levels of vitamin E, and smoking with coronary heart disease in China.
17337886 2007 Associations between the CYBA 242C/T and the MPO -463G/A polymorphisms, oxidative stress and cardiovascular disease in chronic kidney disease patients.
17336700 2007 A genome-wide search for linkage to renal function phenotypes in West Africans with type 2 diabetes.
17314996 2007 Non-effect of p22-phox -930A/G polymorphism on end-organ damage in Brazilian hypertensive patients.
17307262 2007 Impact of NAD(P)H oxidase p22 phox gene polymorphism on vascular aging in Korean centenarian and nonagenarian.
17227953 2007 Regulation of phagocyte NADPH oxidase activity: identification of two cytochrome b558 activation states.
17200123 2007 NAD(P)H oxidases regulate HIF-2alpha protein expression.
17151330 2007 NADPH oxidase p22phox and catalase gene variants are associated with biomarkers of oxidative stress and adverse outcomes in acute renal failure.
17149600 2007 Genetic polymorphisms in the oxidative stress pathway and susceptibility to non-Hodgkin lymphoma.
17140397 2007 Critical roles for p22phox in the structural maturation and subcellular targeting of Nox3.
17126813 2007 Interaction between the SH3 domains and C-terminal proline-rich region in NADPH oxidase organizer 1 (Noxo1).
17015440 2006 Analysis of human phagocyte flavocytochrome b(558) by mass spectrometry.
16998253 2006 Identification of genetic factors and development of genetic risk diagnosis systems for cardiovascular diseases and stroke.
16923427 2006 The p22phox C242T gene polymorphism is associated with a reduced risk of angiographically verified coronary artery disease in a high-risk Finnish Caucasian population. The Finnish Cardiovascular Study.
16922713 2006 Relationship between common functional polymorphisms of the p22phox gene (-930A > G and +242C > T) and nephropathy as a result of Type 2 diabetes in a Chinese population.
16899095 2006 NADPH oxidase (CYBA) and FcgammaR polymorphisms as risk factors for aggressive periodontitis: a case-control association study.
16895900 2006 Deletion mutagenesis of p22phox subunit of flavocytochrome b558: identification of regions critical for gp91phox maturation and NADPH oxidase activity.
16794479 2006 The C242T CYBA polymorphism of NADPH oxidase is associated with essential hypertension.
16788250 2006 C242T polymorphism in CYBA gene (p22phox) and risk of coronary artery disease in a population of Caucasian Italians.
16754784 2006 Cannabidiol-induced apoptosis in human leukemia cells: A novel role of cannabidiol in the regulation of p22phox and Nox4 expression.
16738684 2006 NAD(P)H oxidase p22phox gene C242T polymorphism, nitric oxide production, salt sensitivity and cardiovascular risk factors in Hispanics.
16608528 2006 Genetic polymorphisms and susceptibility to lung disease.
16546843 2006 Effect of doxazosin on oxidative stress related proteins in essential hypertensive patients.
16543247 2006 Polymorphisms in oxidative stress genes and risk for non-Hodgkin lymphoma.
16460309 2006 Activation of the superoxide-producing phagocyte NADPH oxidase requires co-operation between the tandem SH3 domains of p47phox in recognition of a polyproline type II helix and an adjacent alpha-helix of p22phox.
16358232 Relationship of p22phox C242T polymorphism with nephropathy in type 2 diabetic patients.
16330681 2005 NAD(P)H oxidase and multidrug resistance protein genetic polymorphisms are associated with doxorubicin-induced cardiotoxicity.
16326715 2006 NMR solution structure of the tandem Src homology 3 domains of p47phox complexed with a p22phox-derived proline-rich peptide.
16308493 2005 Vasospastic angina and microvascular angina are differentially influenced by PON1 A632G polymorphism in the Japanese.
16293794 2006 Coronary artery superoxide production and nox isoform expression in human coronary artery disease.
16215641 2005 Haplotype analysis of NAD(P)H oxidase p22 phox polymorphisms in end-stage renal disease.
16115038 NADPH oxidase-mediated oxidative stress: genetic studies of the p22(phox) gene in hypertension.
16110781 2005 Common polymorphisms in critical genes of innate immunity do not contribute to the risk for chronic disseminated candidiasis in adult leukemia patients.
16076760 2005 Genetic polymorphisms of oxidative and antioxidant enzymes and arsenic-related hypertension.
16002772 2005 NADPH oxidase p22phox gene variants are associated with systemic oxidative stress biomarker responses to exercise training.
15994299 2005 Point mutations in the proline-rich region of p22phox are dominant inhibitors of Nox1- and Nox2-dependent reactive oxygen generation.
15936011 2005 A beneficial effect of simvastatin on DNA damage in 242T allele of the NADPH oxidase p22phox in hypercholesterolemic patients.
15927447 2006 Functional analysis of Nox4 reveals unique characteristics compared to other NADPH oxidases.
15865106 No association between genetic polymorphisms in NAD(P)H oxidase p22phox and paraoxonase 1 and colorectal cancer risk.
15838728 Genetic variants of TP53 and EPHX1 in Leber's hereditary optic neuropathy and their relationship to age at onset.
15824103 2005 The NADPH oxidase Nox3 constitutively produces superoxide in a p22phox-dependent manner: its regulation by oxidase organizers and activators.
15683718 2005 The expression of the NADPH oxidase subunit p22phox is regulated by a redox-sensitive pathway in endothelial cells.
15671602 2005 Association analysis between hypertension and CYBA, CLCNKB, and KCNMB1 functional polymorphisms in the Japanese population--the Suita Study.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15585859 2004 Site-specific inhibitors of NADPH oxidase activity and structural probes of flavocytochrome b: characterization of six monoclonal antibodies to the p22phox subunit.
15561711 2005 Identification of a novel partner of duox: EFP1, a thioredoxin-related protein.
15538122 2004 Impact of myeloperoxidase and NADPH-oxidase polymorphisms in drug-induced agranulocytosis.
15530459 2004 Lack of association of eNOS (G894T) and p22phox NADPH oxidase subunit (C242T) polymorphisms with systemic sclerosis in a cohort of French Caucasian patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461271 2004 [Study on the relationship between the polymorphism of P22phox C242T, vitamin E and coronary heart disease].
15322091 2004 Direct interaction of the novel Nox proteins with p22phox is required for the formation of a functionally active NADPH oxidase.
15322037 2004 Neutrophil NADPH oxidase is reduced at the Anaplasma phagocytophilum phagosome.
15256399 2004 Systemic regulation of vascular NAD(P)H oxidase activity and nox isoform expression in human arteries and veins.
15255799 2004 Endothelial venodilator response in carriers of genetic polymorphisms involved in NO synthesis and degradation.
15219943 2004 Investigation of genetic polymorphisms and smoking in a bladder cancer case-control study in Argentina.
15210651 2004 Functional effect of the p22phox -930A/G polymorphism on p22phox expression and NADPH oxidase activity in hypertension.
15193812 2004 Angiotensin-converting enzyme and p22(phox) polymorphisms and the risk of coronary heart disease in a low-risk Spanish population.
15186954 2004 Functional effects of NAD(P)H oxidase p22(phox) C242T mutation in human leukocytes and association with thrombotic cerebral infarction.
15172469 2004 Genetic risk and gene-environment interaction in coronary artery spasm in Japanese men and women.
15167446 2004 Genetic analysis of 22 candidate genes for hypertension in the Japanese population.
15135268 2004 Genetic risk for restenosis after coronary balloon angioplasty.
15102859 2004 Binding of FAD to cytochrome b558 is facilitated during activation of the phagocyte NADPH oxidase, leading to superoxide production.
15078863 2004 C242T CYBA polymorphism of the NADPH oxidase is associated with reduced respiratory burst in human neutrophils.
14968555 2004 [Genetic risk factors for ischemic cerebrovascular disease--analysis on fifteen candidate prothrombotic gene polymorphisms in the Japanese population].
14747204 2004 Relation between development of nephropathy and the p22phox C242T and receptor for advanced glycation end product G1704T gene polymorphisms in type 2 diabetic patients.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14679084 2003 Nicotinamide adenine dinucleotide phosphate oxidase (NADPH oxidase) P22 Phox C242T gene polymorphism in type 1 diabetes.
14652666 2004 Role of p22phox in angiotensin II and platelet-derived growth factor AA induced activator protein 1 activation in vascular smooth muscle cells.
14578247 2003 Association of the p22phox component of NAD(P)H oxidase with susceptibility to diabetic nephropathy in patients with type 1 diabetes.
12927691 2003 NAD(P)H oxidase p22phox Gene C242T polymorphism and lipoprotein oxidation.
12772776 2003 Inhibition of the neutrophil NADPH oxidase by adenosine is associated with increased movement of flavocytochrome b between subcellular fractions.
12729892 2003 Preliminary characterisation of the promoter of the human p22(phox) gene: identification of a new polymorphism associated with hypertension.
12716910 2003 Novel human homologues of p47phox and p67phox participate in activation of superoxide-producing NADPH oxidases.
12697486 2003 C242T p22phox gene polymorphism in the population of Han nationality in Guangdong province.
12679469 2003 Monocyte NADPH oxidase subunit p22(phox) and inducible hemeoxygenase-1 gene expressions are increased in type II diabetic patients: relationship with oxidative stress.
12639216 2003 The C242T p22phox polymorphism and endothelium-dependent vasodilation in subjects with hypercholesterolaemia.
12547880 2003 Association of NAD(P)H oxidase p22 phox gene variation with advanced carotid atherosclerosis in Japanese type 2 diabetes.
12514663 2003 Potential thrombophilic mutations/polymorphisms in patients with no flow-limiting stenosis after myocardial infarction.
12482831 2002 Cytochrome b558-dependent NAD(P)H oxidase-phox units in smooth muscle and macrophages of atherosclerotic lesions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446192 2002 Analysis of several hundred genetic polymorphisms may improve assessment of the individual genetic burden for coronary artery disease.
12230880 2002 The A640G and C242T p22(phox) polymorphisms in patients with coronary artery disease.
12226552 2002 NAD (P) H oxidase p22 phox C242T polymorphism affects LDL particle size and insulin resistance in Japanese subjects.
12147803 2002 No association between a genetic variant of the p22(phox) component of NAD(P)H oxidase and the incidence and progression of IgA nephropathy.
12121978 2002 A 29-kDa protein associated with p67phox expresses both peroxiredoxin and phospholipase A2 activity and enhances superoxide anion production by a cell-free system of NADPH oxidase activity.
12056906 2002 Phosphorylation of p47phox sites by PKC alpha, beta II, delta, and zeta: effect on binding to p22phox and on NADPH oxidase activation.
12042318 2002 Mutagenesis of p22(phox) histidine 94. A histidine in this position is not required for flavocytochrome b558 function.
12005167 2002 Study of NADPH oxidase-activated sites in human neutrophils.
11940577 2002 Tumor necrosis factor-alpha increases airway smooth muscle oxidants production through a NADPH oxidase-like system to enhance myosin light chain phosphorylation and contractility.
11917128 2002 Assembly of the neutrophil respiratory burst oxidase: a direct interaction between p67PHOX and cytochrome b558 II.
11910303 2002 Increased free radical production in hypertension due to increased expression of the NADPH oxidase subunit p22(phox) in lymphoblast cell lines.
11893732 2002 Intracellular localization and preassembly of the NADPH oxidase complex in cultured endothelial cells.
11733522 2002 Mapping of functional domains in the p22(phox) subunit of flavocytochrome b(559) participating in the assembly of the NADPH oxidase complex by "peptide walking".
11530961 2001 Genetic factors associated with endothelial dysfunction affect the early onset of coronary artery disease in Korean males.
11258927 2001 Small angle neutron scattering and gel filtration analyses of neutrophil NADPH oxidase cytosolic factors highlight the role of the C-terminal end of p47phox in the association with p40phox.
11133215 2001 NADH/NADPH oxidase p22 phox gene polymorphism is associated with improved coronary endothelial vasodilator function.
11023926 2000 Functional effect of the C242T polymorphism in the NAD(P)H oxidase p22phox gene on vascular superoxide production in atherosclerosis.
10914676 2000 Statistical and mutational analysis of chronic granulomatous disease in Japan with special reference to gp91-phox and p22-phox deficiency.
10910929 2000 Molecular analysis of 9 new families with chronic granulomatous disease caused by mutations in CYBA, the gene encoding p22(phox).
10759707 2000 Genetic studies of three Japanese patients with p22-phox-deficient chronic granulomatous disease: detection of a possible common mutant CYBA allele in Japan and a genotype-phenotype correlation in these patients.
10486263 1999 Rac1 disrupts p67phox/p40phox binding: a novel role for Rac in NADPH oxidase activation.
9083043 1997 p40(phox) down-regulates NADPH oxidase activity through interactions with its SH3 domain.
8920944 1996 Superoxide release and NADPH oxidase components in mature human phagocytes: correlation between functional capacity and amount of functional proteins.
8798532 1996 p22phox is a critical component of the superoxide-generating NADH/NADPH oxidase system and regulates angiotensin II-induced hypertrophy in vascular smooth muscle cells.
8168815 1994 Identification of allele-specific p22-phox mutations in a compound heterozygous patient with chronic granulomatous disease by mismatch PCR and restriction enzyme analysis.
7964505 1994 156Pro-->Gln substitution in the light chain of cytochrome b558 of the human NADPH oxidase (p22-phox) leads to defective translocation of the cytosolic proteins p47-phox and p67-phox.
7938008 1994 Assembly of the phagocyte NADPH oxidase: binding of Src homology 3 domains to proline-rich targets.
3368442 1988 Primary structure and unique expression of the 22-kilodalton light chain of human neutrophil cytochrome b.
3305576 1987 Purified cytochrome b from human granulocyte plasma membrane is comprised of two polypeptides with relative molecular weights of 91,000 and 22,000.
2469497 1989 Characterization of two monoclonal antibodies against cytochrome b558 of human neutrophils.
2286377 1990 The alpha subunit of cytochrome b-245 mapped to chromosome 16.
2243141 1990 Human neutrophil cytochrome b light chain (p22-phox). Gene structure, chromosomal location, and mutations in cytochrome-negative autosomal recessive chronic granulomatous disease.
1763037 1991 Point mutation in the cytoplasmic domain of the neutrophil p22-phox cytochrome b subunit is associated with a nonfunctional NADPH oxidase and chronic granulomatous disease.
1415254 1992 Cytochrome b558-negative, autosomal recessive chronic granulomatous disease: two new mutations in the cytochrome b558 light chain of the NADPH oxidase (p22-phox).