Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 0.7

Expression

AA Sequence

MMAEREEDDDTEEAWMQLRPTEPLPSQCCGSGCSPCVFDLYHRDLARWEAAQASKDRSLLRGPESQSCPS      1 - 70
KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVDDLEIQRAYTPISPANAEGYF     71 - 140
EVLIKCYQMGLMSRYVESWRVGDTAFWRGPFGDFFYKPNQYGELLLLAAGTGLAPMVPILQSITDNENDE    141 - 210
TFVTLVGCFKTFESIYLKTFLQEQARFWNVRTFFVLSQESSSEQLPWSYQEKTHFGHLGQDLIKELVSCC    211 - 280
RRKPFALVCGSAEFTKDIARCLLCAGLTEDSYFLF                                       281 - 315
//

Text Mined References (4)

PMID Year Title