Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.51
PubTator Score 1.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.000 2.5e-02
ependymoma -2.300 3.1e-02
oligodendroglioma -1.800 4.5e-02
group 4 medulloblastoma -1.500 3.3e-03
glioblastoma 1.300 3.7e-02
non-small cell lung cancer 1.324 5.1e-07
active Crohn's disease 1.116 1.2e-02
interstitial cystitis -1.500 6.8e-05
non primary Sjogren syndrome sicca 1.100 1.9e-02
lung carcinoma -1.600 2.1e-24
Pick disease -1.500 1.8e-03
progressive supranuclear palsy -1.300 2.0e-02

Gene RIF (4)

PMID Text
26323991 Study showed that multifocal or multicentric glioblastomas have some underlying genetic and epigenetic characteristics that are associated with poor prognosis and that CYB5R2 is a new epigenetic marker for glioblastoma prognosis
24338690 findings suggest that CYB5R2 may be a functional tumor suppressor gene, frequently inactivated by hypermethylation of its promoter in nasopharyngeal carcinoma
20877624 Observational study of gene-disease association. (HuGE Navigator)
15858218 CYB5R2 is a key enzyme involved in the mediation of NADH-induced redox activity in human spermatozoa.

AA Sequence

MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYT      1 - 70
PVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTS     71 - 140
EPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFNL    141 - 210
WYTLDRPPIGWKYSSGFVTADMIKEHLPPPAKSTLILVCGPPPLIQTAAHPNLEKLGYTQDMIFTY        211 - 276
//

Text Mined References (15)

PMID Year Title
26323991 2015 Genetic, epigenetic, and molecular landscapes of multifocal and multicentric glioblastoma.
25416956 2014 A proteome-scale map of the human interactome network.
24338690 2014 Cytochrome b5 reductase 2 is a novel candidate tumor suppressor gene frequently inactivated by promoter hypermethylation in human nasopharyngeal carcinoma.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15858218 2005 Identification of cytochrome-b5 reductase as the enzyme responsible for NADH-dependent lucigenin chemiluminescence in human spermatozoa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10611283 1999 Identification of a cytochrome b-type NAD(P)H oxidoreductase ubiquitously expressed in human cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.