Property Summary

NCBI Gene PubMed Count 58
PubMed Score 1711.17
PubTator Score 49.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -3.400 3.6e-09
psoriasis 1.200 8.3e-04
cystic fibrosis and chronic rhinosinusit... -1.098 3.5e-02
Atopic dermatitis -1.200 2.3e-03
adrenocortical adenoma -2.033 4.9e-03
adrenocortical carcinoma -1.950 4.0e-05
pancreatic ductal adenocarcinoma liver m... -3.235 1.2e-03
non-small cell lung cancer -1.776 2.1e-17
intraductal papillary-mucinous carcinoma... -1.400 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.400 4.2e-03
lung cancer -2.500 6.7e-06
interstitial cystitis -2.400 4.1e-06
non primary Sjogren syndrome sicca 1.200 1.4e-02
aldosterone-producing adenoma -2.344 1.6e-02
lung adenocarcinoma -1.500 1.3e-06
Polycystic Ovary Syndrome 1.064 3.2e-02
lung carcinoma -2.200 2.8e-31
gastric carcinoma -1.200 2.3e-02
acute myeloid leukemia -2.400 4.7e-02
ovarian cancer -2.100 2.3e-07
chronic rhinosinusitis -1.393 8.0e-03
pancreatic cancer -1.300 2.2e-03
dermatomyositis 1.200 5.4e-04

Protein-protein Interaction (8)

Gene RIF (25)

PMID Text
26587646 We conclude that cytochrome b5 can influence the electronic conductivity of cytochrome P450c17 via allosteric, protein-protein interactions.
25890314 CYB5A is the first RA susceptibility gene involved in androgen synthesis. Our functional analysis of SNP rs1790834 indicates that it contributes to the sex bias observed in RA.
25315771 Two acidic residues, Glu-48 and Glu-49, of cytochrome b5 are essential for stimulating the 17,20-lyase activity of CYP17A1.
25225034 Variants in CYB5A and CYB5R3 should be considered in the evaluation of breast cancer risk in African American women.
24832628 both area and ratio of 3betaHSD and CYB5A double positive cells, which could represent the hybrid cells of zona fasciculate and zona reticularis, are correlated with adrenal development and could influence age-related serum androstenedione levels.
24448000 raises the possibility that inhibition of CYB5A-deregulated downstream pathways, such as those involving TRAF6, may favor autophagy-mediated cancer cell death in selected subgroups of patients
24319746 Cytochrome b5 seems to play the key role in the formation of lipid-radical cycles in membranes.
24301457 Results define CYB5A as a novel prognostic factor for PDAC that exerts its tumor-suppressor function through autophagy induction and TRAF6 modulation.
24151200 CYB5A, which has a role in stearyl-CoA-desaturase activity, and RNF10, with an unknown role in weight regulating pathways, associated with adiposity and nominally increased the risk for T2D in American Indians.
23620596 CYP17A1/b5 interaction is stronger when the hydroxylase substrate pregnenolone is present in the CYP17A1 active site than when the lyase substrate 17alpha-hydroxypregnenolone is in the active site.
22170710 Identification of the first human CYB5A missense mutation as the cause of isolated 17,20 lyase deficiency in three individuals with 46,XY disorder of sex development.
21185375 Human adrenal cells that express both 3beta-hydroxysteroid dehydrogenase type 2 (HSD3B2) and cytochrome b5 (CYB5A) contribute to adrenal androstenedione production
20511233 Cygb has a nitric-oxide dioxygenase function and ascorbate and cytochrome b(5) have roles as reductants
20080843 We demonstrated 17,20-lyase deficiency due to an aberrant CytB5.
19997042 novel cSNPs associated with significantly altered protein expression and/or hydroxylamine reduction activities, but only minimally impact overall observed phenotypic variability
18299324 Cytochrome b(5) rather than O(2)(*-) plays a major role in the activation of IDO in human cells.
17691855 The recombinant fused enzymes CYP3A4-truncated (t)-P450 reductase-t-b5 (3RB) and CYP3A4-t-b5-t-P450 reductase (3BR) in yeast microsomes showed a higher specific activity in 6beta-hydroxylation of testosterone than did the reconstitution premixes.
17622936 These data indicate that a naturally occurring variant in cyt b5, T60A, leads to modestly altered affinity for hydroxylamine substrates and dramatically reduced cyt b5 expression.
17446262 Cytochrome b5 can alter multiple steps in the catalytic cycle via complex interactions with CYP2C9 and P450 reductase.
17320757 cytochrome b(5) has a role in the generation of hydroxyl radicals
16679316 CYP2E1-b(5) complex model was constructed, leading to improved insights into the protein interaction.
15831526 cytochrome b5 gene transcription is regulated by Sp3, GATA-6, and steroidogenic factor 1 in human adrenal NCI-H295A cells
15687493 Data suggest that cytochrome b5 and phosphorylation enhance 17,20 lyase activity independently of each other, probably by increasing the interaction between P450c17 and NADPH-cytochrome P450 oxidoreductase.
14985252 Colocalization of CytB5 and P450c17 strongly supports the view that CytB5 plays an important role in the regulation of the androgen biosynthetic pathway in the fetal and adult human.
14733950 mitochondrial and microsomal cytochromes b(5) exhibit divergent structural and biophysical characteristics

AA Sequence

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST      1 - 70
DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED           71 - 134
//

Text Mined References (63)

PMID Year Title
26587646 2015 Mechanistic Scrutiny Identifies a Kinetic Role for Cytochrome b5 Regulation of Human Cytochrome P450c17 (CYP17A1, P450 17A1).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25890314 2015 CYB5A polymorphism increases androgens and reduces risk of rheumatoid arthritis in women.
25315771 2014 Catalytically relevant electrostatic interactions of cytochrome P450c17 (CYP17A1) and cytochrome b5.
25225034 2014 Polymorphisms in the carcinogen detoxification genes CYB5A and CYB5R3 and breast cancer risk in African American women.
24832628 2015 3?HSD and CYB5A double positive adrenocortical cells during adrenal development/aging.
24448000 2014 CYB5A and autophagy-mediated cell death in pancreatic cancer.
24319746 2013 Role of cytochrome b5 and ?-tocopherol to microsomal and mitochondrial oxidation.
24301457 2014 Role of CYB5A in pancreatic cancer prognosis and autophagy modulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24151200 2014 Whole exome sequencing identifies variation in CYB5A and RNF10 associated with adiposity and type 2 diabetes.
23620596 2013 Substrate-modulated cytochrome P450 17A1 and cytochrome b5 interactions revealed by NMR.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
22170710 2012 A missense mutation in the human cytochrome b5 gene causes 46,XY disorder of sex development due to true isolated 17,20 lyase deficiency.
21269460 2011 Initial characterization of the human central proteome.
21185375 2011 Human adrenal cells that express both 3?-hydroxysteroid dehydrogenase type 2 (HSD3B2) and cytochrome b5 (CYB5A) contribute to adrenal androstenedione production.
20511233 2010 Nitric-oxide dioxygenase function of human cytoglobin with cellular reductants and in rat hepatocytes.
20080843 2010 Isolated 17,20-lyase deficiency due to the cytochrome b5 mutation W27X.
19997042 2010 Cytochrome b5 and NADH cytochrome b5 reductase: genotype-phenotype correlations for hydroxylamine reduction.
19946888 2010 Defining the membrane proteome of NK cells.
18299324 2008 Cytochrome b5, not superoxide anion radical, is a major reductant of indoleamine 2,3-dioxygenase in human cells.
17691855 2007 Molecular characterization of specifically active recombinant fused enzymes consisting of CYP3A4, NADPH-cytochrome P450 oxidoreductase, and cytochrome b5.
17622936 2007 Discovery and characterization of a cytochrome b5 variant in humans with impaired hydroxylamine reduction capacity.
17446262 2007 CYP2C9 protein interactions with cytochrome b(5): effects on the coupling of catalysis.
17320757 2007 Reduction of hexavalent chromium by human cytochrome b5: generation of hydroxyl radical and superoxide.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16679316 2006 Identification of the interactions between cytochrome P450 2E1 and cytochrome b5 by mass spectrometry and site-directed mutagenesis.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15831526 2005 Regulation of cytochrome b5 gene transcription by Sp3, GATA-6, and steroidogenic factor 1 in human adrenal NCI-H295A cells.
15687493 2005 Regulation of 17,20 lyase activity by cytochrome b5 and by serine phosphorylation of P450c17.
15680923 2005 Interactions of mammalian cytochrome P450, NADPH-cytochrome P450 reductase, and cytochrome b(5) enzymes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14985252 2004 Colocalization of P450c17 and cytochrome b5 in androgen-synthesizing tissues of the human.
14739275 2004 Neuronal calcium sensor protein visinin-like protein-3 interacts with microsomal cytochrome b5 in a Ca2+-dependent manner.
14733950 2004 Mammalian mitochondrial and microsomal cytochromes b(5) exhibit divergent structural and biophysical characteristics.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11867265 2002 Assessment of the ability of type 2 cytochrome b5 to modulate 17,20-lyase activity of human P450c17.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9813010 1998 Charged amino acids at the carboxyl-terminal portions determine the intracellular locations of two isoforms of cytochrome b5.
9760250 1998 The influence of mutation at Glu44 and Glu56 of cytochrome b5 on the protein's stabilization and interaction between cytochrome c and cytochrome b5.
9601054 1998 Control of androgen biosynthesis in the human through the interaction of Arg347 and Arg358 of CYP17 with cytochrome b5.
9398194 1997 Kinetics of ferric cytochrome P450 reduction by NADPH-cytochrome P450 reductase: rapid reduction in the absence of substrate and variations among cytochrome P450 systems.
8262522 1993 The human cytochrome b5 gene and two of its pseudogenes are located on chromosomes 18q23, 14q31-32.1 and 20p11.2, respectively.
8168836 1994 A splicing mutation in the cytochrome b5 gene from a patient with congenital methemoglobinemia and pseudohermaphrodism.
7733981 1995 The isolation and characterization of the human cytochrome b5 gene.
7668255 1995 A novel point mutation in a 3' splice site of the NADH-cytochrome b5 reductase gene results in immunologically undetectable enzyme and impaired NADH-dependent ascorbate regeneration in cultured fibroblasts of a patient with type II hereditary methemoglobinemia.
7649306 1995 The targeting information of the mitochondrial outer membrane isoform of cytochrome b5 is contained within the carboxyl-terminal region.
6102994 1980 Characterization of the interaction of amphipathic cytochrome b5 with stearyl coenzyme A desaturase and NADPH:cytochrome P-450 reductase.
5062820 1972 Cytochrome b 5 from a normal human liver. Isolation and the partial amino acid sequence.
4993957 1971 Amino acid sequences of tryptic peptides of cytochromes b5 from microsomes of human, monkey, porcine, and chicken liver.
4770377 1973 Structural studies of cytochrome b5. 3. Sequential studies on human liver cytochrome b5.
4373719 1974 Purification and properties of rat liver microsomal stearyl coenzyme A desaturase.
4030743 1985 Amino acid sequences of cytochrome b5 from human, porcine, and bovine erythrocytes and comparison with liver microsomal cytochrome b5.
3951505 1986 Congenital methemoglobinemia with a deficiency of cytochrome b5.
3178851 1988 The complete nucleotide sequence of human liver cytochrome b5 mRNA.
2752049 1989 Structure of cytochrome b5 and its topology in the microsomal membrane.
2123873 1990 Characterization of the covalent cross-links of the active sites of amidinated cytochrome b5 and NADH:cytochrome b5 reductase.
1840560 1991 Chromosomal localization of a cytochrome b5 gene to human chromosome 18 and a cytochrome b5 pseudogene to the X chromosome.
1712589 1991 The human liver and reticulocyte cytochrome b5 mRNAs are products from a single gene.
1396600 1992 The carboxy-terminal 10 amino acid residues of cytochrome b5 are necessary for its targeting to the endoplasmic reticulum.
221468 1979 Modification and identification of cytochrome b5 carboxyl groups involved in protein-protein interaction with cytochrome b5 reductase.
199233 1977 Effect of modification of individual cytochrome c lysines on the reaction with cytochrome b5.