Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.13
PubTator Score 46.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.600 1.2e-03
ductal carcinoma in situ 1.300 6.7e-03
invasive ductal carcinoma 1.800 7.5e-04
oligodendroglioma -1.600 3.0e-02
osteosarcoma -1.413 1.2e-02
ovarian cancer 1.100 7.9e-04
pancreatic cancer -1.500 8.9e-04
Pick disease -1.100 6.7e-03
posterior fossa group B ependymoma 1.100 5.4e-06
primary pancreatic ductal adenocarcinoma -1.483 2.1e-03
psoriasis -1.900 5.3e-05

Gene RIF (5)

AA Sequence

MEGGAAAATPTALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIGLIFLQGNALL      1 - 70
VYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGF     71 - 140
SFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSAFEPEGVLANVLGLLLAC    141 - 210
FGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ                                 211 - 251
//

Text Mined References (18)

PMID Year Title