Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2844 2.6e-19
osteosarcoma 7933 6.2e-09

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -3.930 6.2e-09
lung carcinoma -1.200 2.6e-19

AA Sequence

MFIFIKHGDNQQFLVNTNCAVVVLLYYIRSKVKLPKTNTIDLCEQTGKMKMLFLMKPNHAEYASKYLTAR      1 - 70
STYYVCKVERGPPGTRLENAYRAFVPLLKNPEPWLLVALRIQCDALERRRIQMLKMKEAKKVVIIEPPAS     71 - 140
VPSKQSGRSDKKKSTRKSPTFRNRPDFRKNKGRQLNKTTKQKK                               141 - 183
//

Text Mined References (3)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.