Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.09
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
chronic lymphocytic leukemia -1.671 5.1e-08
malignant mesothelioma -3.000 1.1e-08
psoriasis -1.100 2.6e-03
posterior fossa group B ependymoma 2.400 8.1e-10
atypical teratoid / rhabdoid tumor -1.200 3.7e-02
medulloblastoma, large-cell -2.100 1.1e-03
tuberculosis -1.100 4.1e-05
lung cancer -1.700 1.7e-05
interstitial cystitis -2.400 1.5e-05
lung adenocarcinoma -1.100 4.6e-15
pilocytic astrocytoma 1.700 1.4e-05
lung carcinoma 1.700 4.5e-18
Pick disease -1.100 3.9e-04
Breast cancer -2.300 5.5e-12
acute myeloid leukemia -1.200 1.2e-02
ovarian cancer -3.300 2.0e-19
chronic rhinosinusitis -1.414 9.1e-03
cystic fibrosis and chronic rhinosinusit... -1.338 3.9e-02

AA Sequence

MSGESGQPEAGPSHAGLDWPNPERNRAGVPGGVIRRAGSQGPRSWIQKVLEQIMDSPRQCVTPSEVVPVT      1 - 70
VLAVQRYLLEDEPRDTVPKPPLYCYDVTISDGVYQEKCYLDPSLNSLVYQNILKVGIQMRISRVSCLYNE     71 - 140
KRIGQGILCIDNVHCGETSDSISLETPFRNRAHQEKPERPLRGGKSHYLALWNNEDPYGDIWLTDKQPEE    141 - 210
HNFSDTKIISLSHLEMTWTNRRNFPALLVRILHKSKLRYYGKPDKKMIEPYQTFLEVADSSGTVSVIMWN    211 - 280
ALCPEWYKSLRVGLVLLLQDYSVKKSYPFRIQPVPVDPQIKLISTMEICLNLRDPPTNIIIIPEKQVKPE    281 - 350
WRLPKLNHRFTTRSELDDMPENCICDVIGLLVFVGRVQRSKKKENREDFWSYRWIHIADGTSEQPFIVEL    351 - 420
FSTSQPEIFENIYPMAYFVCTQLKVVRNDNQVPKLLYLTTTNESGVFITGHRGQPYTYDAKVKNFIQWIR    421 - 490
TKSDSGEQKNMVIGGYYPYPPVPETFSKYSSSIKVESLLTAISEVRKEIEDLQYREQKRIAIQGIITAIK    491 - 560
YIPHSSATESASASETLRNANRPSTSQAARVEIQERNGKRHQDDEPVNSQYFQTTSTNLSLSNKIRILQG    561 - 630
PHANPVAVPQPGASVQTKGIKPGMPSIFNRRANINANLQGKARKTISDRWESQLWREKKFGLIDHLHYSR    631 - 700
VYPESIPRKFMFEHRKFLSDQYNSQPAKYVPPEGRPPKLDDFKSARSLGHFEVTILGLNHEIAIDVAFLP    701 - 770
MYCPEDIRTSQIDTLLTSMNYSCAYPQDTTGNDRLPGPRAVAGDIIKAATELDRVHIVGILDICNLGNNK    771 - 840
VEVYLHKIYSPENTS                                                           841 - 855
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.