Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.700 4.4e-03
ovarian cancer 1.400 2.3e-04
subependymal giant cell astrocytoma 1.051 4.8e-02
ulcerative colitis 1.300 7.6e-06

AA Sequence

MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVCRGGSRCSPRA      1 - 70
RQFQPQCQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKQGPEECDAVALLS     71 - 140
LINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQMKIQNFLNEFKNIPEIVAVYSRIEQLLT    141 - 210
SDWAVHIPEEDQRDGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLR    211 - 280
NNEDLRNGLTEDMQKLDSLCLHQKLDSQEPGRQTPDRKA                                   281 - 319
//

Text Mined References (11)

PMID Year Title