Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.54
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2844 4.5e-16
lung cancer 4473 3.2e-04
osteosarcoma 7933 2.8e-03
gastric carcinoma 832 9.8e-03
cutaneous lupus erythematosus 1056 4.8e-02

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 4.8e-02
osteosarcoma -1.003 2.8e-03
lung cancer -1.100 3.2e-04
lung carcinoma -1.800 4.5e-16
gastric carcinoma 1.100 9.8e-03

AA Sequence

MLSEGYLSGLEYWNDIHWSCASYNEQVAGEKEEETNSVATLSYSSVDETQVRSLYVSCKSSGKFISSVHS      1 - 70
RESQHSRSQRVTVLQTNPNPVFESPNLAAVEICRDASRETYLVPSSCKSICKNYNDLQIAGGQVMAINSV     71 - 140
TTDFPSESSFEYGPLLKSSEIPLPMEDSISTQPSDFPQKPIQRYSSYWRITSIKEKSSLQMQNPISNAVL    141 - 210
NEYLEQKVVELYKQYIMDTVFHDSSPTQILASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMS    211 - 280
TEITEISTPSLHISQYSNVNP                                                     281 - 301
//

Text Mined References (6)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.