Property Summary

NCBI Gene PubMed Count 65
PubMed Score 128.26
PubTator Score 367.64

Knowledge Summary

Patent (19,155)

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 2.700 1.6e-04
interstitial cystitis 1.900 7.1e-03
osteosarcoma -1.709 2.0e-05
primary Sjogren syndrome 1.200 2.0e-03
psoriasis 1.600 4.5e-04
tuberculosis -2.900 7.7e-08

Protein-protein Interaction (1)

Gene RIF (69)

AA Sequence

MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFL      1 - 70
VNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQ     71 - 140
QAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVC    141 - 210
YSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLR    211 - 280
ACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL            281 - 342
//

Text Mined References (65)

PMID Year Title