Property Summary

NCBI Gene PubMed Count 81
PubMed Score 264.13
PubTator Score 165.36

Knowledge Summary

Patent (29,385)

Protein-protein Interaction (8)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
540340 confirmatory 0 / 0 / 19 SAR analysis counterscreen of small molecule antagonists of the CCR6 receptor using a CXCR5 receptor luminescent beta-arrestin assay
651594 confirmatory 2 / 0 / 0 Dose Response counterscreen of small molecule antagonists of the CXCR6 receptor using a CXCR5 receptor luminescent beta-arrestin assay
651601 confirmatory 1 / 0 / 5 SAR analysis of small molecule antagonists of the CXCR6 receptor in a screening panel assay
651919 confirmatory 6 / 0 / 30 SAR analysis of small molecule antagonists of the CXCR6 receptor in a screening panel assay - 4

Gene RIF (65)

PMID Text
26818544 HCV infection increased the frequency of CD4+CXCR5+ T cells and decreased the frequency of CD27+IgG+ B cells. CD4+CXCR5+ T cells activated CD27+IgG+ B cells via the secretion of IL-21.
26752644 findings reveal a neuronal/astrocytic interaction in the spinal cord by which neuronally produced CXCL13 activates astrocytes via CXCR5 to facilitate neuropathic pain.
26640404 down-regulation of CXCR5 inhibited the growth and proliferation of LNCaP cells.
26517519 In patients with HBV-related hepatocellular carcinoma the phenotype and function of CXCR5+CD45RA-CD4+ T cells were altered.
26462153 Authors demonstrate that CD40 expression upregulates the chemokine receptor CXCR5 and promotes MDSC migration toward and accumulation within cancer.
26333070 study showed that induction of circulating CXCR5+CD4+ Tfh-like subsets can be detected following immunization with HPV vaccines, and potentially be useful as a marker of immunogenicity of vaccines
25786345 elevated CXCR5 expression may contribute to abnormal cell survival and migration in breast tumors that lack functional p53.
25714983 IL-33 enhances humoral immunity against chronic hbv infection through activating CD4(+)CXCR5(+) helper-Inducer T-Lymphocytes.
25666935 A negative correlation between levels of miR-346 and percentages of CD4(+)CXCR5(+) T cells was confirmed in Graves' disease
25654980 Circulating CXCR5+CD4+helper T cells in systemic lupus erythematosus patients share phenotypic properties with germinal center follicular helper T cells and promote antibody production.
25476740 our findings suggest that CXCL13-CXCR5 axis promotes the growth, migration, and invasion of colon cancer cells, probably via PI3K/AKT pathway
25279986 11q23.3 with rs4938573 near CXCR5 gene is associated with follicular lymphoma.
25271023 After validation in larger patient groups, CXCR5 and CXCL13 may prove useful as biomarkers for nonsmall cell lung carcinoma Correspondingly, blockade of this axis could serve as an effective therapy for nonsmall cell lung carcinoma.
25077417 three SNPs (rs497916, rs3922, rs676925) in CXCR5 and one SNP (rs355687) in CXCL13 were associated with hepatitis B vaccine efficacy
25015289 FANCA-modulated neddylation pathway involved in CXCR5 membrane targeting and cell mobility.
25010623 Expression features of CXCR5 and its ligand, CXCL13 associated with poor prognosis of advanced colorectal cancer
24966908 CD4+CXCR5+ helper T cells may contribute to the pathogenesis of primary Sjogren's syndrome by promoting the maturation of B cells.
24833093 healthy controls with rs6421571CT and TT genotypes had higher mRNA and protein levels of CXCR5 than those with wild-type CC genotype specifically in CD4+ T cells
24732574 Suggest that platelet-mediated signaling through CXCR5 may be active in vivo during plaque destabilization, enhancing the anti-inflammatory effects of CXCL13.
24489825 HIV-1 Nef induces variable levels of CXCR5 downregulation in different cell types
24337540 expression of CXCR5 was significantly associated with both stage and lymph node metastasis, but not with tumor size, tumor differentiation grade, or menopausal status of the patient.
24138884 Circulating precursor cd4+ T cells expressing CCR7(low)PD-1(high) CXCR5+ indicate T-helper cell activity and promote antibody responses upon antigen re-exposure.
24035365 Human circulating memory T-helper cells expressing PD-1 and CXCR5 are highly functional and correlate with broadly neutralizing HIV antibody responses.
24001599 study discovered multiple susceptibility variants for systemic lupus erythematosus in the 11q23.3 region, including variants in/near PHLDB1 (rs11603023), DDX6 (rs638893) and CXCR5 (rs10892301)
23812490 Results provide additional evidence for a role of host genetic variation in CXCR5 in lymphomagenesis, particularly for FL.
23807677 Data suggest the involvement of CD4+ CXCR5+ T cells (circulating follicular helper T cells Tfh) in the pathogenesis and progression of chronic lymphocytic leukemia (CLL).
23773523 specific G protein isoforms coupled to CXCR5 in its resting and active states, were identified.
23739915 A single nucleotide polymorphism in CXCR5, rs630923, is associated with genetic risk for multiple sclerosis.
23250934 Polymorphisms in CXCR5 are associated with HIV-associated non-hodgkin B-cell lymphoma.
23189125 Interruption of CXCL13-CXCR5 axis increases upper genital tract pathology and activation of NKT cells following chlamydial genital infection.
22913878 Data indicate that EBI2 expression modulates CXCL13 binding affinity to CXCR5.
22840692 Levels of CXCL13 are increased in carotid atherosclerosis both systemically and within the atherosclerotic lesion. Based on our in vitro findings, we hypothesize a potential plaque stabilizing effects of CXCL13-CXCR5 interaction
22707196 C-X-C chemokine receptor type 5 gene polymorphisms are associated with non-Hodgkin lymphoma.
22607768 The CXCL13-CXCR5 axis is associated with classic determinants of poor prognosis, such as high grade, hormone receptor negativity, and axillary node involvement.
21785430 A Bcl-6-CXCR5 axis in T(reg) cells drive the development of follicular regulatory T cells that function to inhibit germinal center reactions.
21750724 Data indicate that the percentages of CD4(+)CXCR5(+) TFH in IA patients were positively correlated with AST.
21642390 these results add new information about the CXCL13-CXCR5 axis in neuroblastic tumors and in the crosstalk between neuroblastic and stromal cells.
21471443 Central memory CD4 T cells expressing CXCR5 efficiently induced PC differentiation and Ig secretion, and displayed a different profile in terms of cytokine and costimulatory molecule expression.
20809769 Sections of the mouse CXCR5 intron significantly align plus/plus with sections of the human intron; the aligned segments are in the same order in mouse as in man and overall cover 13% of the mouse sequence and 17% of the human sequence.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20412587 CXCL13 caused CXCR5-dependent activation of the PI3Kp85alpha in prostate cancer cells
19955043 Results suggest that BLC/CXCL13 as well as its corresponding receptor, CXCR5, may play important roles in the pathogenesis of SLE and in lupus nephritis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19610059 Overexpression of CXCR5 is associated with prostate cancer.
19536742 Low-expression frequency for the chemokine receptor CXCR5 is associated with mediastinal large B-cell lymphoma.
19375853 the CXCL13-CXCR5 axis is significantly associated with prostate cancer progression
19228923 High levels of CXCR5 is associated with mantle cell lymphoma.
19074885 Observational study of gene-disease association. (HuGE Navigator)
18780835 Altered expression of the chemokine receptor-ligand pair, CXCR5/CXCL13, may participate in the establishment of B-cell dysfunctions during HIV-1 infection.
18528326 Most B cells expressed CXCR5.
17786442 CXCR5 is the first chemokine receptor so far identified able to attract in vitro primary metastatic neuroblastoma cells
17652619 CXCR5 plays a role in Chronic lymphocytic leukemia (CLL) cell positioning and cognate interactions between CLL and CXCL13-secreting CD68+ accessory cells in lymphoid tissues.
17018614 Expression of CXCR5 on tumor cells promotes the growth of colon carcinoma cells in the liver.
17015714 expression of CXCR5 identifies a unique subset of Vgamma9Vdelta2 T cells which express the costimulatory molecules ICOS and CD40L, secrete IL-2, IL-4, and IL-10 and help B cells for Ab production
16888899 CCR7 and CXCR5 are differentially expressed on the cell surface of lymphocytes and dendritic cells depending of the stage of cellular differentiation and activation. (review)
16318584 elevated levels of CXCL13 could cause impaired or altered trafficking of B cells during HIV infection and could contribute to the previously reported loss of CXCR5
16225771 Data show that CXCL13 and CCL19 together by means of activation of CXCR5 and CCR7 up-regulated PEG10 expression and function in leukemic B cells.
15780119 Potenetial role of CXCL13 and its specific receptor CXCR5 in recruitment of B cells in renal allograft rejection.
15713799 studies suggest that IRBP and S-Ag can initiate innate and, in sensitive individuals, adaptive immune response by attracting iDCs and T and B cells expressing CXCR3 and CXCR5
14763921 CXCR5 and CXCL13 play an essential role in maintaining B- and T-cells in lymphocytic infiltrates and ectopic follicles in thyroid tissue from patients affected by autoimmunity.
14618028 Data demonstrate a significant age-dependent difference in the response of osteoblasts to CXCR3 and CXCR5 activation.
12324654 Data show that blr1 was induced early during cell differentiation and because its overexpression accelerated monocytic differentiation, it may be important for signals controlling cell differentiation.
12070001 Most Natural killer t-cells express receptors for extralymphoid tissue or inflammation-related chemokines (CCR2, CCR5, and CXCR3), while few NKT cells express lymphoid tissue-homing chemokine receptors (CCR7 and CXCR5).
11714765 CXCR5 is a common and early marker for newly generated memory CD4+ T cell subsets during ongoing immune responses.
11688722 structural requirements for the activation of signal transduction pathways by CXCR5

AA Sequence

MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSLIFLLGVIGNV      1 - 70
LVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTFLCKTVIALHKVNFYCSSLLL     71 - 140
ACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLLALPEILFAKVSQGHHNNSLPRCTFSQENQA    141 - 210
ETHAWFTSRFLYHVAGFLLPMLVMGWCYVGVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIF    211 - 280
LDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQ    281 - 350
LFPSWRRSSLSESENATSLTTF                                                    351 - 372
//

Text Mined References (82)

PMID Year Title
26818544 2016 CD4+CXCR5+ T cells activate CD27+IgG+ B cells via IL-21 in patients with hepatitis C virus infection.
26752644 2016 CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5.
26640404 2015 The Differential Expression and Function of the Inflammatory Chemokine Receptor CXCR5 in Benign Prostatic Hyperplasia and Prostate Cancer.
26517519 2015 Phenotype and function of CXCR5+CD45RA-CD4+ T cells were altered in HBV-related hepatocellular carcinoma and elevated serum CXCL13 predicted better prognosis.
26462153 2015 CD40 controls CXCR5-induced recruitment of myeloid-derived suppressor cells to gastric cancer.
26333070 2015 Circulating CXCR5?CD4? T Follicular-Like Helper Cell and Memory B Cell Responses to Human Papillomavirus Vaccines.
25786345 2015 p53-dependent expression of CXCR5 chemokine receptor in MCF-7 breast cancer cells.
25714983 2015 IL-33 Enhances Humoral Immunity Against Chronic HBV Infection Through Activating CD4(+)CXCR5(+) TFH Cells.
25666935 2015 MiR-346 regulates CD4?CXCR5? T cells in the pathogenesis of Graves' disease.
25654980 2015 Circulating CXCR5+CD4+helper T cells in systemic lupus erythematosus patients share phenotypic properties with germinal center follicular helper T cells and promote antibody production.
25476740 2015 CXCL13-CXCR5 axis promotes the growth and invasion of colon cancer cells via PI3K/AKT pathway.
25279986 2014 Genome-wide association study identifies five susceptibility loci for follicular lymphoma outside the HLA region.
25271023 2014 Expression and clinical significance of CXCR5/CXCL13 in human non?small cell lung carcinoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25077417 2014 Genetic polymorphisms of CXCR5 and CXCL13 are associated with non-responsiveness to the hepatitis B vaccine.
25015289 2014 Proteomic analysis reveals a FANCA-modulated neddylation pathway involved in CXCR5 membrane targeting and cell mobility.
25010623 2014 Expression features of CXCR5 and its ligand, CXCL13 associated with poor prognosis of advanced colorectal cancer.
24966908 2014 CD4+CXCR5+ follicular helper T cells in salivary gland promote B cells maturation in patients with primary Sjogren's syndrome.
24833093 2014 C-X-C chemokine receptor type 5 gene polymorphism affects gene expression in CD4+ T cells and is associated with increased risk of colorectal cancer.
24732574 2014 Activated platelets promote increased monocyte expression of CXCR5 through prostaglandin E2-related mechanisms and enhance the anti-inflammatory effects of CXCL13.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24337540 2014 CXCL13-CXCR5 co-expression regulates epithelial to mesenchymal transition of breast cancer cells during lymph node metastasis.
24138884 2013 Circulating precursor CCR7(lo)PD-1(hi) CXCR5? CD4? T cells indicate Tfh cell activity and promote antibody responses upon antigen reexposure.
24035365 2013 Human circulating PD-1+CXCR3-CXCR5+ memory Tfh cells are highly functional and correlate with broadly neutralizing HIV antibody responses.
24001599 2014 Three SNPs in chromosome 11q23.3 are independently associated with systemic lupus erythematosus in Asians.
23812490 2013 CXCR5 polymorphisms in non-Hodgkin lymphoma risk and prognosis.
23807677 2013 Association of peripheral CD4+ CXCR5+ T cells with chronic lymphocytic leukemia.
23773523 2013 Differential G protein subunit expression by prostate cancer cells and their interaction with CXCR5.
23739915 2013 MANBA, CXCR5, SOX8, RPS6KB1 and ZBTB46 are genetic risk loci for multiple sclerosis.
23250934 2013 Serum levels of the chemokine CXCL13, genetic variation in CXCL13 and its receptor CXCR5, and HIV-associated non-hodgkin B-cell lymphoma risk.
23189125 2012 Interruption of CXCL13-CXCR5 axis increases upper genital tract pathology and activation of NKT cells following chlamydial genital infection.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22913878 2012 EBI2 regulates CXCL13-mediated responses by heterodimerization with CXCR5.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
22840692 2012 Increased levels of the homeostatic chemokine CXCL13 in human atherosclerosis - Potential role in plaque stabilization.
22707196 2012 C-X-C chemokine receptor type 5 gene polymorphisms are associated with non-Hodgkin lymphoma.
22607768 2012 Improved outcome of high-risk early HER2 positive breast cancer with high CXCL13-CXCR5 messenger RNA expression.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21785430 2011 Follicular regulatory T cells expressing Foxp3 and Bcl-6 suppress germinal center reactions.
21750724 2011 High frequency of CD4+ CXCR5+ TFH cells in patients with immune-active chronic hepatitis B.
21642390 2011 Role of CXCL13-CXCR5 crosstalk between malignant neuroblastoma cells and Schwannian stromal cells in neuroblastic tumors.
21471443 2011 CXCR5 expressing human central memory CD4 T cells and their relevance for humoral immune responses.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
20809769 2011 An analysis of the human and mouse CXCR5 gene introns.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20412587 2010 PI3Kp110-, Src-, FAK-dependent and DOCK2-independent migration and invasion of CXCL13-stimulated prostate cancer cells.
19955043 2010 Serum BLC/CXCL13 concentrations and renal expression of CXCL13/CXCR5 in patients with systemic lupus erythematosus and lupus nephritis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19610059 2009 Clinical and biological significance of CXCR5 expressed by prostate cancer specimens and cell lines.
19536742 2009 Identification of a chemokine receptor profile characteristic for mediastinal large B-cell lymphoma.
19375853 2009 Serum CXCL13 positively correlates with prostatic disease, prostate-specific antigen and mediates prostate cancer cell invasion, integrin clustering and cell adhesion.
19228923 2009 Mantle cell lymphoma cells express high levels of CXCR4, CXCR5, and VLA-4 (CD49d): importance for interactions with the stromal microenvironment and specific targeting.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18780835 2008 Altered expression of the receptor-ligand pair CXCR5/CXCL13 in B cells during chronic HIV-1 infection.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18528326 2008 Analysis and classification of B-cell infiltrates in lupus and ANCA-associated nephritis.
17786442 2008 CXCR5 may be involved in the attraction of human metastatic neuroblastoma cells to the bone marrow.
17652619 2007 Overexpression of the CXCR5 chemokine receptor, and its ligand, CXCL13 in B-cell chronic lymphocytic leukemia.
17018614 2006 The CXCR5 chemokine receptor is expressed by carcinoma cells and promotes growth of colon carcinoma in the liver.
17015714 2006 CXCR5 identifies a subset of Vgamma9Vdelta2 T cells which secrete IL-4 and IL-10 and help B cells for antibody production.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16888899 2003 Shaping up adaptive immunity: the impact of CCR7 and CXCR5 on lymphocyte trafficking.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16318584 2005 Serum levels of the homeostatic B cell chemokine, CXCL13, are elevated during HIV infection.
16225771 2004 PEG10 activation by co-stimulation of CXCR5 and CCR7 essentially contributes to resistance to apoptosis in CD19+CD34+ B cells from patients with B cell lineage acute and chronic lymphocytic leukemia.
15780119 2005 BCA-1/CXCL13 expression is associated with CXCR5-positive B-cell cluster formation in acute renal transplant rejection.
15713799 2005 Autoantigens signal through chemokine receptors: uveitis antigens induce CXCR3- and CXCR5-expressing lymphocytes and immature dendritic cells to migrate.
15251452 2004 CCL3, acting via the chemokine receptor CCR5, leads to independent activation of Janus kinase 2 (JAK2) and Gi proteins.
14763921 2004 The role of CXCR5 and its ligand CXCL13 in the compartmentalization of lymphocytes in thyroids affected by autoimmune thyroid diseases.
14618028 2003 Age-associated changes in functional response to CXCR3 and CXCR5 chemokine receptors in human osteoblasts.
12620646 2003 Regulation of chemokine receptor expression in human microglia and astrocytes.
12578791 2003 Expression of chemokine receptors, CXCR4 and CXCR5, and chemokines, BLC and SDF-1, in the eyes of patients with primary intraocular lymphoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447991 2003 Human osteoblasts express functional CXC chemokine receptors 3 and 5: activation by their ligands, CXCL10 and CXCL13, significantly induces alkaline phosphatase and beta-N-acetylhexosaminidase release.
12324654 2002 Ectopic expression of CXCR5/BLR1 accelerates retinoic acid- and vitamin D(3)-induced monocytic differentiation of U937 cells.
12171958 2002 B cell attracting chemokine 1 (CXCL13) and its receptor CXCR5 are expressed in normal and aberrant gut associated lymphoid tissue.
12070001 2002 Trafficking machinery of NKT cells: shared and differential chemokine receptor expression among V alpha 24(+)V beta 11(+) NKT cell subsets with distinct cytokine-producing capacity.
9486651 1998 A B-cell-homing chemokine made in lymphoid follicles activates Burkitt's lymphoma receptor-1.
9463416 1998 B cell-attracting chemokine 1, a human CXC chemokine expressed in lymphoid tissues, selectively attracts B lymphocytes via BLR1/CXCR5.
7639692 1995 Sequence variation of a novel heptahelical leucocyte receptor through alternative transcript formation.
1425907 1992 Differentiation-specific expression of a novel G protein-coupled receptor from Burkitt's lymphoma.