Property Summary

Ligand Count 112
NCBI Gene PubMed Count 1,274
PubMed Score 2525.26
PubTator Score 3388.38

Knowledge Summary

Patent (288,649)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (38)

Disease log2 FC p
adult high grade glioma 1.700 2.6e-03
astrocytoma 2.000 2.8e-13
Astrocytoma, Pilocytic 1.900 2.8e-06
Atopic dermatitis 1.700 7.0e-03
atypical teratoid / rhabdoid tumor 3.500 1.3e-05
Breast cancer 1.200 8.5e-03
breast carcinoma 1.300 1.9e-16
cutaneous lupus erythematosus 3.000 4.5e-03
cystic fibrosis 1.400 1.5e-03
dermatomyositis 2.100 5.4e-04
Down syndrome 1.500 3.7e-02
ductal carcinoma in situ 2.100 9.9e-04
ependymoma 1.500 9.9e-03
esophageal adenocarcinoma 1.100 2.0e-02
gastric carcinoma 1.900 4.4e-02
glioblastoma 1.800 1.3e-06
interstitial cystitis 1.800 4.8e-02
invasive ductal carcinoma 1.411 1.4e-02
juvenile dermatomyositis 1.310 1.5e-07
lung cancer -1.400 1.0e-02
lung carcinoma -1.800 7.4e-11
malignant mesothelioma 3.800 2.4e-07
medulloblastoma 1.600 1.0e-02
medulloblastoma, large-cell 1.900 3.1e-03
nephrosclerosis 1.147 9.7e-03
oligodendroglioma 1.600 2.6e-08
osteosarcoma -2.886 2.0e-04
ovarian cancer 1.400 5.0e-04
pancreatic cancer 1.400 6.6e-03
periodontitis 1.800 1.1e-32
pituitary cancer -2.100 3.0e-06
primary pancreatic ductal adenocarcinoma 1.342 4.8e-02
primary Sjogren syndrome 1.700 2.7e-05
primitive neuroectodermal tumor 3.200 1.1e-04
psoriasis 1.300 5.6e-06
tuberculosis -1.400 1.0e-05
ulcerative colitis 2.800 5.5e-04
Waldenstrons macroglobulinemia 1.482 2.9e-02

Protein-protein Interaction (1)

PDB (10)

Gene RIF (1696)

AA Sequence

MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLR      1 - 70
SMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVH     71 - 140
ATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLIL    141 - 210
PGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTV    211 - 280
HKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFH    281 - 350
SS                                                                        351 - 352
//

Text Mined References (1287)

PMID Year Title