Property Summary

NCBI Gene PubMed Count 219
PubMed Score 788.33
PubTator Score 500.92

Knowledge Summary

Patent (65,086)

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 1.3e-03
tuberculosis -2.200 2.4e-08
breast carcinoma 1.300 6.9e-04
interstitial cystitis 1.500 2.6e-03
invasive ductal carcinoma 1.100 2.1e-02
psoriasis 1.400 2.7e-28

Protein-protein Interaction (5)

Gene RIF (196)

PMID Text
26831417 Both CXCL10 and CXCR3 appeared to be useful in differentiating T1R reaction in borderline leprosy while CXCR3 alone differentiated BT from BT-T1R
26823797 CXCR3 expression was upregulated in advanced gastric cancer and was associated with increased CD4+, CD8+ tumor-infiltrating lymphocyte infiltration and improved overall survival
26506526 congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP.
26434630 our study suggested a potential use of CXCR3 overexpression as a prognostic marker for gastric cancer
26394162 CXCR3 was also linked to steatosis through inducing hepatic lipogenic genes
26339376 Suggest that aberrant CXCR3 expression may play crucial roles in suppressing prostate carcinoma metastasis by inhibiting cell proliferation and invasion through the PCLbeta signaling pathway.
26209629 Results indicate that CXC chemokine receptors 3 (CXCR3) contributes to spontaneous preterm birth (SPTB).
26164305 This study is aimed at the optimization of a new analytical method for metabolic profiling with parallel bioaffinity assessment of CXCR3 ligands of the azaquinazolinone and piperazinyl-piperidine class and their metabolites.
26037167 The expression of the chemokine receptors CXCR3, CXCR4 and CXCR7 and their ligands.
25858769 Common variants of CXCR3 and its ligands CXCL10 and CXCL11 are associated with vascular permeability of dengue infection in peninsular Malaysia.
25768944 CD4+ T cells demonstrated markedly decreased CXCR3 expression.
25760840 CXCR3 and IP-10 are involved in the pathogenesis of bronchiolitis, and CXCR3 is associated with allergic factors.
25663474 CXCR3-A, the predominant form in hematopoietic cells, mediates tumor "go" signaling by promoting cell proliferation, survival, chemotaxis, invasion and metastasis; while CXCR3-B, on epithelial cells, mediates "stop" signaling
25537642 Targeting of both CXCR3 isoforms may be important to block the stem cell-promoting actions of CXCR3-B, while inhibiting the pro-proliferative and metastasis-promoting functions of CXCR3-A.
25527046 High expression of CXCR3 is associated with glioblastoma patients with an invasive phenotype.
25514189 Expression of CXCR3 in fibroblasts is associated with the expression of IL-13Ralpha2.
25275127 HIV-1 Vpu downregulates the cell surface expression of chemokine (C-X-C motif) receptor 3 (CXCR3, CD183)
25232565 CXCR3 has been demonstrated to be strongly related to tumour progression in advanced colorectal cancer.
25178112 The different groups of clinically stable nonallergic asthmatic patients showed distinct patterns of alterations in subset distribution as well as CCR6, CXCR3, and CCR5 expression on circulating T lymphocytes.
25013801 Higher percentages of CCR4+ CD4 TEM cells in acute RSV infection were accompanied with higher percentages of CXCR3+ CD8 TEM cells, whereas the development of long-lived memory CXCR3+ CD4 and CD8 TCM cells seems to be compromised
24907118 Report crosstalk between TGF-beta1 and CXCR3 signaling in the regulation of urethral fibrosis.
24890729 interfering with IL-1beta and IL-12 signaling in Th17 cells during inflammation may be a promising therapeutic approach to reduce their differentiation into "pathogenic" CCR6+ CXCR3+ Th1/17 cells in patients with autoimmune diseases.
24715380 We show here for the first time that CXCL10 and CXCR3 expression are both predictors of favorable outcome in patients treated with tamoxifen.
24586509 the participation of the chemokine CXCL10/CXCR3 axis in celiac disease pathogenesis
24530757 The CXCR3 polymorphism rs34334103 was associated with male gender and pleuritis in patients with SLE.
24526602 CXCR3 interacts with CXCL11 on brain microvascular endothelial cells.
24489825 HIV-1 Vpu downregulates the cell surface expression of chemokine (C-X-C motif) receptor 3 (CXCR3, CD183)
24366869 CXCR3-B mediates a growth-inhibitory signal in breast cancer cells through the modulations of nuclear translocation of Bach-1 and Nrf2 and down-regulation of HO-1.
24318111 Both EMAP II and CXCR3 were essentially required for gp120-induced lung microvascular endothelial cell apoptosis.
24318111 HIV-1 Vpu downregulates the cell surface expression of chemokine (C-X-C motif) receptor 3 (CXCR3, CD183)
24135023 Pericytes regulate angiogenic vessel formation, and this is mediated through CXCR3 expressed on endothelial cells.
24129241 CCR5-Delta32 polymorphism and CXCR3/CCR5 underexpression influence downregulation of the corresponding receptors in TILs.
24124129 plays a role in insulin resistance and obesity-induced visceral adipose inflammation
23994383 Post-transplant enhanced CXCL10/CXCR3 signaling in small-for-size liver grafts directly induced endothelial progenitor cell mobilization
23773308 CXCR3, CXCR4, CXCR7 have similar transmembrane helices, different conformations of N-terminal, C-terminal regions and extracellular loops, and interaction between the three receptors and CXCL11 and CXCL12 are on a hydrophobic and electrostatic basis.
23643635 Upregulation of CXCR3 expression on CD8+ T cells due to the pervasive influence of chronic hepatitis B and C virus infection.
23600831 CXCR3 expression on CD4(+) T cells was fivefold higher in those from CSF than blood, but was not increased in paediatric opsoclonus-myoclonus syndrome.
23333304 HIV-1 Vpu downregulates the cell surface expression of chemokine (C-X-C motif) receptor 3 (CXCR3, CD183)
23298254 Data indicate that women with systemic lupus erythematosus (SLE) responded similar to pregnancy as did healthy women with lower percentages of CCR2+, CCR5+ and CXCR3+ monocytes.
23179902 Bortezomib significantly decreases CXCR3 expression on T cells & their CD4(+)/CD8(+) subsets in a dose-dependent manner.
23158864 CXCR3 expression was higher in immune thrombocytopenic purpura patients (prior to treatment and in remission) than in healthy controls.
23121557 Data suggest that co-expression of CCX-CKR (atypical chemokine receptor 4) and CXCR3 in T-lymphocytes results in protein multimerization and prevents CXCR3-mediated chemotaxis; this represents a novel mechanism of regulation of immune cell migration.
22936405 Protein nitration was required for CXCR3 receptor up-regulation by cigarette smoke and for CXCR3-induced cell death.
22798340 natural CXCR3(+) T-bet(+) Treg selectively accumulate in ovarian tumors to control type I T-cell responses, resulting in the collateral limitation of efficient antitumor immunity.
22796894 CXCR3 promotes recruitment of Th17 cells from the blood into the liver in both human and murine liver injury. Their subsequent positioning near bile ducts is dependent on CCR6 and cholangiocyte-secreted CCL20.
22792160 Intra-hepatic accumulation of the functionally impaired CXCR3(+)CD56Bright NK cell subset might be involved in HCV-induced liver fibrosis.
22689289 Both CXCR3 and CXCR4 are involved in metastasis of colorectal cancer to lymph nodes, lungs and liver.
22685032 CXCL10 and CXCR3 were upregulated in colonic mucosa in active inflammatory bowel disease (IBD). The TLR3-ligand poly(I:C) increased release of CXCL10 in colonic epithelial cell lines, suggesting a TLR3-mediated CXCL10 release in IBD patients.
22675496 The chemokine CXCL12, its truncated form SDF-1(5-67), and the receptors CXCR4 and CXCR3 are expressed in human glaucomatous trabecular tissue and a human trabecular cell line.
22401929 high level of CXCR3 protein expression was significantly associated with tumor differentiation, tumor size, lymph node metastasis, distant metastasis, and Dukes' classification in patients with colorectal carcinoma
22392992 CXCR3 agonist induces receptor cross-phosphorylation within CXCR3-CCR5 heterodimers on the surface of activated T cells
22369302 CXCR3 expression was associated with epidermotropic T cell tumors but was greatly absent in dermal ones. Scattered or diffuse CD30 expression in transformed mycosis fungoides was not associated with an absence of CXCR3 expression.
22262158 Chemokine gene-expression patterns were consistent with an angiogenic-angiostatic imbalance and a downregulation of CXCR3 receptor-mediated signaling in the PCs from obese subjects.
22236567 aberrant expression of CXCR3A and down-regulation of CXCR3B may switch a progression "stop" to a "go" signal to promote prostate tumor metastasis via stimulating cell migration and invasion.
22111598 CD8(+) lymphocytes from HIV/HCV-infected patients expressed more CXCR3 and showed greater upregulatory ability upon activation.
22079021 The data supported a role for CCR5, CXCR3, and CXCR6 in the selective recruitment of T cells into renal cell carcinoma tissue and, together with CCR6, in the recruitment of regulatory T cells.
21962843 Elevated plasma levels of interferon-gamma and Cys-X-Cys chemokine receptor 3-binding chemokines are present in patients with thoracic aortic aneurysms.
21811993 We describe and characterize a new autocrine/paracrine role of CXCL10/CXCR3 in the regulation of fibroblast-like synoviocyte invasion in rats with arthritis and in rheumatoid arthritis patients.
21739422 CCR4-, CCR5-, CXCR3-, and selectin ligand-expressing CD4+ T cells preferentially accumulate in the joints of children with juvenile idiopathic arthritis.
21645215 CXCR3 ligands, CXCL9,10,11, are differentially expressed during chronic liver diseases across different disease stages and aetiologies.
21538345 Results demonstrate that the peripheral homing receptor CXCR3 is expressed on subset(s) of circulating Tregs and suggest a role for CXCR3 in their recruitment into peripheral sites of inflammation.
21426802 CXCR3 was up-regulated in breast cancer and was associated with disease progression.
21357438 Suggest decreased CXCR3 expression in CD4+ T cells exposed to asbestos or derived from asbestos-exposed patients may contribute to reduced antitumor immune function.
21303517 These results show that while the expression of MIG/CXCL9 and IP-10/CXCL10 are elevated in Systemic sclerosis (SSc) serum, the expression of CXCR3 is downregulated on SSc dermal Endothelial cells.
21303425 Suggest that the renal TWEAK/Fn14 and IP-10/CXCR3 axis may contribute to the pathogenesis of lupus nephritis.
21274647 HIV-1 Vpu downregulates the cell surface expression of chemokine (C-X-C motif) receptor 3 (CXCR3, CD183)
21255008 Results demonstrated the expression of CXCR3 as well as of two of its known variants, CXCR3-B and CXCR3-alt, in ex vivo activated T lymphocytes.
21148743 expression of CXC chemokine receptor 3 is reduced with continuous exposure to asbestos in a human T-cell line, MT-2
21091908 suggesting that gliadin-induced IL-8 production was CXCR3-dependent gliadin induced IL-8 production only in coeliac disease
21087446 Increased numbers of immature plasma cells may migrate towards inflammatory sites of ulcerative colitis (UC) via the CXCR3 axis, and may participate in UC pathogenesis.
21051441 CXCR3 antagonism exerts a direct anti-glioma effect and this receptor may be a potential therapeutic target for treating human glioma.
20980681 both CXCR3A and CXCR3B are implicated in the chemotactic and vascular effects of CXCL4L1.
20856926 CXCL10 inhibits endothelial cell proliferation independently of CXCR3.
20855888 Down-regulation of CXCR3-B is associated with renal cancer.
20848514 this study provides evidence of the significant overexpression of the CXCR3 axis in active IBD, suggesting it has a role in IBD pathogenesis.
20733031 reveal a CXCR3-dependent accumulation and activation of perivascular macrophages as a necessary step in homeostatic arterial remodeling triggered by hemodynamic stress in mice and possibly in humans as well.
20529825 The expression and function of CXCR3 and CXCR7 receptors in cervical carcinoma, rhabdomyosarcoma and glioblastoma cell lines, was evaluated.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20429924 Above median expression of CXCR2, CXCR3 and CCR1 in the tumour islets is associated with increased survival in non-small cell carcinoma, and expression of CXCR3 correlates with increased macrophage and mast cell infiltration in the tumour islets.
20379873 The expression of CXCR3 and its atypical variants at both mRNA and protein levels, was examined.
20377416 The CD27(+) B-cell population was found to highly express CXCR3 in chronic hepatitis C (CHC), thus suggesting that the CD27(+) B-cell population was recruited from peripheral blood to the inflammatory site of the liver of CHC.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20228225 CXCR3 and its ligands may be important autocrine and/or paracrine signaling mediators in the tumorigenesis of basal cell carcinomas
20203286 the absence of CXCR3(-/-) signaling network results in hypertrophic and hypercellular scarring characterized by on-going wound regeneration, cellular proliferation, and scars
20185576 CXCR3 signaling has a role in basal cell carcinoma [commentary]
20164417 Liver-infiltrating regulatory T lymphocyte(Treg)s use CXCR3 to undergo transendothelial migration across hepatic sinusoidal endothelium into inflamed sites during chronic and autoimmune liver disease.
20096889 There is over expression of genes related to immune and inflammatory responses, including cytokines such as CXCR3 binding chemokines in interstitial cystitis
20079227 The intensity of IL-16 and CXCR3 expression were correlated with the index of clinical and pulmonary function in COPD.
20059481 Insulitic lesions were characterized by presence of beta cells, elevated levels of the chemokine CXCL10 and infiltration of lymphocytes expressing the corresponding chemokine receptor CXCR3 in all pancreatic lesions of type 1 diabetes patients
20047517 decreased frequency of the M280 allele is an independent risk factor for carotid atherosclerosis in northern China
20041963 CXCL10 induces cell death in human cultured pancreatic cells leading to apoptosis and DNA fragmentation via CXCR3 signalling
19800124 The three-dimensional structure of CXCL9 and CXCR3, and, successively, of the CXCL9/CXCR3 complex were modelled in comparison to CXCL10/CXCR3 and CXCL11/CXCR3 complexes.
19767105 Stimulation of both CXCR3 and the T cell receptor has the potential to enhance specifically both the proliferation and extravasation of specific T cells during episodes of local inflammation.
19758167 Experimental and clinical evidence support the idea that the CXCR3 pathway is involved in the development of autoimmune diseases.
19735481 that the chemokine receptors CXCR1, 3 and 4 modulate some aspects of ASM function but their importance in asthma is uncertain.
19734217 A large portion of infiltrating CD4-positive T cells from lupus nephritis patients express CXCR3 on their surface, whereas no significant CXCR3 positivity is seen on resident kidney cells.
19703720 Adhesion of haematopoietic stem cells to liver compartments is integrin and CD44 dependent and modulated by CXCR3 and CXCR4.
19641142 CXCL10 secreted from beta-cells activates and attracts autoreactive T-cells and macrophages to the islets via CXCR3 in type 1 diabetes.
19539215 Recombinant human granulocyte colony-stimulating factor significantly decreases the expression of CXCR3 and CCR6 on T cells and preferentially induces T helper cells to a T helper 17 phenotype in peripheral blood harvests
19380511 investigated CXCR3-mediated neuronal injury, particularly, its contribution to autophagy suppression and the concomitant effects of antiretroviral therapy
19344719 Report antifibrotic effects of CXCL9 and its receptor CXCR3 in livers of mice and humans.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19232748 Inhibition of CXCR3/IP-10 signaling can be considered as a potential treatment modality for myasthenia gravis.
19134328 The interactions between CXCL9, CXCL10 and CXCL12 expressed in decidua and villi and CXCR3, CXCR4 expressed in CD(56)(+) decidua NK cells may influence the CD(56)(+)NK cell recruitment at the maternal-fetal interface.
19106589 ratio of CCR4+/CXCR3+ cells was 4.45 in chemotherapy and 0.72 in immunotherapy
19017998 infiltrated neutrophils from patients with chronic inflammatory lung diseases and rheumatoid arthritis highly express CCR1, CCR2, CCR3, CCR5, CXCR3, and CXCR4
18962861 rs2280964A allele significantly correlates with decreased CXCR3 gene expression, which would lead to variation in immune cell responses to chemokine-cytokine signals in vitro and ex vivo that includes a decrease in chemotactic activity.
18832436 Calcineurin inhibitors modulate CXCR3 splice variant expression and mediate renal cancer progression
18798334 CXCR3-associated chemokines may play an important role in the development of necroinflammation and fibrosis in the liver.parenchyma in chronic hepatitis C infection.
18761554 Lymphocytes from Crohn's disease patients express a spliced variant of the CXCR3 receptor and suggest a role for the colonic epithelial cells in T-lymphocyte migration in intestinal inflammation.
18729739 IFN-alpha2b possibly controls chemotaxis by regulating the interaction between CXCL10 and CXCR3A
18689270 study revealed that surface expression of the chemokine receptors CXCR3 and CCR5 on CD4+ T cells were increased markedly in patients with active SLE more than SLE patients in remission and the healthy subjects
18616679 We showed that CXCR3 expression was an independent predictive factor for non-responsiveness to H. pylori eradication therapy in patients with gastric MALT lymphoma.
18497951 Expression of CXCR3 was significantly associated with lymph node metastasis in lung adenocarcinoma
18485912 Gliadin binds to CXCR3 and leads to MyD88-dependent zonulin release and increased intestinal permeability
18453591 the activities of CXCR3 are tightly controlled following mRNA translation. such tight regulation of CXCR3 may serve as a control to avoid the unnecessary amplification of activated T lymphocyte recruitment.
18375741 CXCR3 receptor is expressed by human type II pneumocytes, and the CXCR3-A splice variant mediates chemotactic responses possibly through Ca(2+) activation of both mitogen-activated protein kinase and PI 3-kinase signaling pathways.
18291705 Aim of this study was to elucidate the effects of CXCR3-B on activation of members of the mitogen-activated protein kinase family, and to explore the relevance of defined signaling pathways to the angiostatic effects of CXCR3-B ligands.
18280341 CXCR3 <-> ligand-mediated lymphocyte recruitment is involved in cutaneous lichenoid graft-versus-host disease.
18174362 Human chemokine receptor CXCR3 (CXCR3-B) transduces apoptotic but not chemotactic signals in microvascular endothelial cells following exposure to high concentrations of CXCL4.
18037659 In clinically inflamed dental pulp, CXCR3 expression was observed mainly on T-cells.
17947699 IKK2 is also involved in the IFN-gamma-stimulated release of the CXCR3 ligands through a novel mechanism that is independent NF-kappaB
17912012 CXCR3 was expressed strongly at the acinar cell membrane in chronic pancreatitis as compared to normal
17703412 Observational study of gene-disease association. (HuGE Navigator)
17666357 an important role of CXCR3 in the development and progression of atopic dermatitis
17615381 T cells expressing CCR6, CXCR3, and CXCR6 act coordinately with respective ligands and Th1 inflammatory cytokines in the alveolitic/granuloma phases of the disease.
17560677 In chronic hepatitis C, anti-viral treatment induces an increase in CD8+ cells expressing chemokine receptors. Viral control is associated with an increase in CXCR3(high) expressing CD8+ cells during treatment.
17457216 CXCR3 expression on mononuclear cells and CXCR3 ligands in renal cell carcinoma is increased in response to systemic IL-2 therapy
17363734 CD13 rapidly processed CXCL11, but not CXCL8, to generate truncated CXCL11 forms that had reduced binding, signaling, and chemotactic properties for lymphocytes and CXCR3- or CXCR7-transfected cells.
17339184 Low expression of CXCR3 by blood CLL B cells was a clear, independent predictor of death, suggesting that low CXCR3 expression has a role in the invasive capacity and progression of this tumor.
17251291 mutant receptor (CXCR3[K300A, S304E]) showed markedly enhanced HIV coreceptor function compared to the wild-type receptor (CXCR3[WT])
17142784 CXCR3 was expressed in EEC, ESC, and trophoblast cells. Addition of IFN-gamma to EEC increased the chemotactic activity of its culture medium to trophoblast cells and T cells, and the effect was suppressed by Abs of three CXCR3 ligands
17142783 most circulating human CD4+ T cells store the inflammatory chemokine receptors CXCR3 and CXCR1 within a distinct intracellular compartment
17018607 Activation of Ras plays a critical role in modulating the expression of both CXCL10 and CXCR3-B, which may have important consequences in the development of breast tumors through cancer cell proliferation.
16934957 These results indicated that CXCL10 inhibited LNCaP cell proliferation and decreased PSA production by up-regulation of CXCR3 receptor. CXCL10 may be potentially useful in the treatment of prostate cancer.
16930533 analysis of human CXCR3 receptor agonists
16861617 These results together indicate that the expression of CXCR3 is up-regulated on intermediately differentiated memory CD8+ T cells. CXCR3high CD8+ T cells had a greater ability to migrate in response to CXCR3 ligands than CXCR3low ones.
16847335 Data demonstrate that chemokine activation of CXCR3 involves both high-affinity ligand-binding interactions in the extracellular domains of CXCR3 and a lower-affinity receptor-activating interaction in the second extracellular loop.
16787707 IP-10 does not seem to be a risk factor for Alzheimer disease, but a novel rare polymorphism has been identified, which could exert a role in susceptibility.
16733654 Double immunofluorescense staining demonstrated that cellular sources of MCP-1/CCL2 and IP-10/CXCL10 were hypertrophic astrocytes and that both astrocytes and microglia/macrophages expressed CCR2 and CXCR3.
16679918 Patients who had a combined BM relapse had lower IL-8 and CXCR4 expression than those who had an isolated BM relapse om chldhood acute lymphoblastic leukemia.
16456020 epithelial CXCR3 may be involved in postsecretion regulation of chemokine bioavailability
16455991 demonstrate an intimate functional relationship among CD4, CCR5, and CXCR3, in which CCR5 can act as an adaptor molecule for CD4 signaling
16368892 CXCL11-dependent CXCR3 internalization and cell migration are regulated by the CXCR3 membrane proximal carboxyl terminus, whereas adhesion is regulated by the 3i loop S245.
16339779 Activation of CXCR3 exerts a mitogenic effect in human bronchial epithelial cells.
16243485 The frequency of CXCR3-expressing cells in peripheral blood is significantly higher in primary biliary cirrhosis, and CXCR3-positive cells are also found in the portal areas of diseased livers, primarily on CD4-positive T cells.
16127166 Activation of CXCR 3 promotes lymphocyte adhesion and transendothelial migration under flow.
16043121 Observational study of gene-disease association. (HuGE Navigator)
16043121 Our findings suggest that polymorphisms in CXCR3 might be one of the genetic factors for the risk of asthma development, especially in male atopic subjects.
16034118 CXCR3 plays an important role in controlling inflammation of the central nervous system in transgenic mice during intracerebral infection with noncytolytic lymphocytic choriomeningitis virus
16033640 These data suggest that the regulation of the CCL2 and CXCL10 expression exhibit significant differences in their mechanisms, and also demonstrate that the alveolar epithelium contributes to the cytokine milieu of the lung.
15885315 Expression of chemokine receptor CXCR3 mediates the selective accumulation of memory CD4+ T-cells into the cerebrospinal fluid of patients with neuroborreliosis.
15879427 These results suggest that inhibition of the CXCL10/CXCR3 axis offers a novel target for the treatment of asthma.
15856455 recruitment of T cells expressing Cxcr3 into the invasive margin of colorectal cancer.
15843529 CXCR3/IP-10 signaling is associated with the pathogenesis of human myasthenia gravis.
15808644 Marked up-regulation of IP-10 may predict the initial graft injury and the onset of delayed graft function in kidney transplantation.
15725351 These data indicate that IFN-gamma mediates the recruitment of lymphocytes into the lung via production of the chemokine CXCL10, resulting in Tc1-cell alveolitis and granuloma formation.
15713799 studies suggest that IRBP and S-Ag can initiate innate and, in sensitive individuals, adaptive immune response by attracting iDCs and T and B cells expressing CXCR3 and CXCR5
15687242 Once induced in memory B cells, CXCR3 expression remains part of the individual cellular memory
15578697 LMP1-mediated p38/SAPK2 activation induces expression of the chemokine IP-10 and regulates transcript stability
15528361 A splice variant of CXCR3 despite its severe structural changes still localizes to the cell surface and mediates functional activity of CXCL11.
15518810 HIV-1 Vpu downregulates the cell surface expression of chemokine (C-X-C motif) receptor 3 (CXCR3, CD183)
15501397 CXCR3 is the principal inflammatory chemokine receptor involved in Behcet's disease
15328188 CXCR3 and CCR4 were heterogeneously expressed in peripheral T-cell lymphomas.
15265234 The CXCR3 ligands IP-10/CXCL10 & Mig/CXCL9 revealed a proproliferative effect but did not influence apoptosis of mesangial cells, suggesting involvement in processes involved in renal inflammation, regeneration and glomerular homeostasis.
15254596 CXCR3-deficient mice demonstrated increased mortality with progressive interstitial fibrosis, and a reduced early burst of IFN-g, upon injury. CXCR3 deficiency results a deficiency in lung NK cells.
15181567 plays an important role in lymphocyte trafficking to CSF during HIV-1 infection
15155273 autocrine activation of CXCR3 expressed by epithelial cells may contribute to airway inflammation and remodeling in obstructive lung disease by regulating cell migration.
15150261 Intracellular domains of CXCR3 mediate CXCL9, CXCL10, and CXCL11 function
15126579 Mig and IP-10 may be involved in the recruitment of natural killer cells or other phenomena in the human endometrium.
14742268 interstitial CXCR3 may play an important role during progressive loss of renal function
14657006 CXCR3-ligation preferentially augments ongoing Th1 over Th2 responses and suggest that reduced capacity of allergic individuals to respond to CXCR3 ligands promotes the maintenance of human allergic disorders
14630801 HIV-1 Vpu downregulates the cell surface expression of chemokine (C-X-C motif) receptor 3 (CXCR3, CD183)
14618028 Data demonstrate a significant age-dependent difference in the response of osteoblasts to CXCR3 and CXCR5 activation.
14578618 In restinosis, increased plasma concentrations of IP10 were accompanied by a compensatory decrease in the CXCR3 expression on lymphocytes, but not monocytes, suggesting that a high plasma concentration of IP10 strongly induces monocytes signaling.
12960302 CXCR3 functions broadly--on recently activated as well as fully differentiated CD4+ T cells and on cells that participate in the germinal center reaction as well as on those that infiltrate peripheral inflammatory sites.
12960247 In vitro chemotaxis induced by this chemokine is not necessarily predictive of its in vivo lymphocyte-recruiting activity.
12953097 Ligands control plasmacytoid dendritic cell responsiveness to the constitutive chemokine (SDF-1)/CXCL12.
12919091 Targenic of cxcr3 and/or ICOS may have clinical application in the prevention and treatment of chronic allograft nephropathy.
12884299 eosinophil responses mediated by chemokines acting at CCR3 may be regulated by two distinct mechanisms: the antagonistic effects of CXCR3 ligands and the sequestration of CCL11 by CXCR3-expressing cells
12819030 Data suggest that in oral lichen planus, the presence of CCL5 and CXCL10 in the cytolytic granules of tissue-infiltrating CD8(+)T cells expressing CCR5 and CXCR3 reveals a potential self-recruiting mechanism involving activated effector cytotoxic T cells
12782716 alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth
12750173 CXCR3-targeting chemokines control T-cell migration via PTX-sensitive, phospholipase C pathways and phosphatidylinositol kinases other than class I PI3Kgamma.
12688353 CXCR3-Mig-coexpressing lymphoma cells were abundant in high MALT of the stomach and thyroid, but rare in other subtypes
12517959 Activation of the CXCR3 receptor in proximal tubular cells might disturb natriuresis during inflammatory and ischemic kidney disease via early growth response gene-1-mediated imbalance of reactive oxygen species.
12444109 migration of murine and human IFN-producing cells to CXCR3 ligands in vitro requires engagement of CXCR4 by CXCL12
12356205 Significant increase in surface CCR5 in CD4+, CD8+, CD19+ and CD14+ cells as well as an increased percentage of CXCR3 and CXCR4 in CD14+ cells in MS patients.
12270371 Gene expression is predictive for the individual response of children with chronic allograft nephropathy to mycophenolate mofetil.
12097412 Expression of CXCR3 ligands (MIG, IP-10, and ITAC) in the bronchoalveolar lavage fluid of transplantation recipients is associated with persistent recruitment of mononuclear cells, a pivotal event in the pathogenesis of bronchiolitis obliterans syndrome.
12070001 Most Natural killer t-cells express receptors for extralymphoid tissue or inflammation-related chemokines (CCR2, CCR5, and CXCR3), while few NKT cells express lymphoid tissue-homing chemokine receptors (CCR7 and CXCR5).
12016104 These findings suggest that the CXCR3/CXCL10 axis may be involved in the T cell recruitment that occurs in peripheral airways of smokers with COPD and that these T cells may have a type-1 profile.
11990865 Expression of CXCR3 on CD4+ and CD8+ T cells was significantly reduced after 3 months of interferon beta-1a treatment in multiple sclerosis.
11966764 Graves' disease is associated with an altered CXCR3 expression in thyroid-derived compared to peripheral blood t lymphocytes
11739530 downregulation following T cell-endothelial cell contact
11559369 chemokine/CXCR3 activity

AA Sequence

MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLG      1 - 70
NGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGAL     71 - 140
LLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQV    141 - 210
GRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDIL    211 - 280
MDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSS    281 - 350
SRRDSSWSETSEASYSGL                                                        351 - 368
//

Text Mined References (221)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26831417 2015 Is CXCL10/CXCR3 axis overexpression a better indicator of leprosy type 1 reaction than inducible nitric oxide synthase?
26823797 2015 Impact of chemokine receptor CXCR3 on tumor-infiltrating lymphocyte recruitment associated with favorable prognosis in advanced gastric cancer.
26506526 2015 Left Ventricular Dysfunction and CXCR3 Ligands in Hypertension: From Animal Experiments to a Population-Based Pilot Study.
26434630 2015 Overexpression of the chemokine receptor CXCR3 and its correlation with favorable prognosis in gastric cancer.
26394162 2016 CXC chemokine receptor 3 promotes steatohepatitis in mice through mediating inflammatory cytokines, macrophages and autophagy.
26339376 2015 Potential role of CXCR3 in proliferation and invasion of prostate cancer cells.
26209629 2015 CXCR3 Polymorphism and Expression Associate with Spontaneous Preterm Birth.
26164305 2015 Metabolic profiling of ligands for the chemokine receptor CXCR3 by liquid chromatography-mass spectrometry coupled to bioaffinity assessment.
26037167 2015 Expression of the Chemokine Receptors CXCR3, CXCR4, CXCR7 and Their Ligands in Rhabdomyosarcoma.
25858769 2015 Common variants of chemokine receptor gene CXCR3 and its ligands CXCL10 and CXCL11 associated with vascular permeability of dengue infection in peninsular Malaysia.
25768944 2015 Iron prevents the development of experimental cerebral malaria by attenuating CXCR3-mediated T cell chemotaxis.
25760840 2015 [Roles of CXCR3 on lymphocytes and IP-10 of peripheral blood in infants with bronchiolitis].
25663474 2015 CXCR3 in carcinoma progression.
25537642 2015 Divergent roles of CXCR3 isoforms in promoting cancer stem-like cell survival and metastasis.
25527046 2015 High expression of CXCR3 is an independent prognostic factor in glioblastoma patients that promotes an invasive phenotype.
25514189 2015 CXCR3 Requirement for the Interleukin-13-Mediated Up-Regulation of Interleukin-13R?2 in Pulmonary Fibroblasts.
25232565 2014 The expression of chemokine receptors CXCR3 and CXCR4 in predicting postoperative tumour progression in stages I-II colon cancer: a retrospective study.
25178112 2014 Abnormal chemokine receptor profile on circulating T lymphocytes from nonallergic asthma patients.
25013801 2014 The increased type-1 and type-2 chemokine levels in children with acute RSV infection alter the development of adaptive immune responses.
24907118 2014 Crosstalk between TGF-?1 and CXCR3 signaling during urethral fibrosis.
24890729 2014 IL-1? promotes the differentiation of polyfunctional human CCR6+CXCR3+ Th1/17 cells that are specific for pathogenic and commensal microbes.
24715380 2014 C-X-C ligand 10 and C-X-C receptor 3 status can predict tamoxifen treatment response in breast cancer patients.
24586509 2014 Role of CXCR3/CXCL10 axis in immune cell recruitment into the small intestine in celiac disease.
24530757 2014 CXCR3 polymorphism is associated with male gender and pleuritis in patients with systemic lupus erythematosus.
24526602 2014 The involvement of CXCL11 in bone marrow-derived mesenchymal stem cell migration through human brain microvascular endothelial cells.
24366869 2014 A novel CXCR3-B chemokine receptor-induced growth-inhibitory signal in cancer cells is mediated through the regulation of Bach-1 protein and Nrf2 protein nuclear translocation.
24318111 2014 HIV envelope protein gp120-induced apoptosis in lung microvascular endothelial cells by concerted upregulation of EMAP II and its receptor, CXCR3.
24135023 2013 Pericyte regulation of vascular remodeling through the CXC receptor 3.
24129241 2013 CXCR3/CCR5 pathways in metastatic melanoma patients treated with adoptive therapy and interleukin-2.
24124129 2014 CXCR3 modulates obesity-induced visceral adipose inflammation and systemic insulin resistance.
23994383 2014 Post-transplant endothelial progenitor cell mobilization via CXCL10/CXCR3 signaling promotes liver tumor growth.
23773308 2013 Common structural interactions between the receptors CXCR3, CXCR4 and CXCR7 complexed with their natural ligands, CXCL11 and CXCL12, by a modeling approach.
23643635 2013 Upregulation of CXCR3 expression on CD8+ T cells due to the pervasive influence of chronic hepatitis B and C virus infection.
23600831 2013 Expression of CXCR3 and its ligands CXCL9, -10 and -11 in paediatric opsoclonus-myoclonus syndrome.
23298254 2013 Peripheral monocyte expression of the chemokine receptors CCR2, CCR5 and CXCR3 is altered at parturition in healthy women and in women with systemic lupus erythematosus.
23179902 2012 Bortezomib regulates the chemotactic characteristics of T cells through downregulation of CXCR3/CXCL9 expression and induction of apoptosis.
23158864 2012 [The role of CXCR3 and its ligand I-TAC in the pathogenesis of immune thrombocytopenic purpura].
23121557 2013 Inhibition of CXCR3-mediated chemotaxis by the human chemokine receptor-like protein CCX-CKR.
22936405 2012 Cigarette smoke-induced CXCR3 receptor up-regulation mediates endothelial apoptosis.
22798340 2012 CXCR3+ T regulatory cells selectively accumulate in human ovarian carcinomas to limit type I immunity.
22796894 2012 CXCR3-dependent recruitment and CCR6-mediated positioning of Th-17 cells in the inflamed liver.
22792160 2012 The CXCR3(+)CD56Bright phenotype characterizes a distinct NK cell subset with anti-fibrotic potential that shows dys-regulated activity in hepatitis C.
22689289 2013 The role of CXCR3 and CXCR4 in colorectal cancer metastasis.
22685032 2013 Enhanced expression of CXCL10 in inflammatory bowel disease: potential role of mucosal Toll-like receptor 3 stimulation.
22675496 2012 CXCR3 antagonism of SDF-1(5-67) restores trabecular function and prevents retinal neurodegeneration in a rat model of ocular hypertension.
22401929 2012 The prognostic significance of chemokine receptor CXCR3 expression in colorectal carcinoma.
22392992 2012 Chemokine receptor CXCR3 agonist prevents human T-cell migration in a humanized model of arthritic inflammation.
22369302 2012 The expression of CXCR3 and CD30 in mycosis fungoides.
22262158 2012 Early alterations of the immune transcriptome in cultured progenitor cells from obese African-American women.
22236567 2012 Altered CXCR3 isoform expression regulates prostate cancer cell migration and invasion.
22111598 2011 CXCR3 Expression Elevated on Peripheral CD8(+) Lymphocytes from HIV/HCV Coinfected Individuals.
22079021 2012 T lymphocyte recruitment into renal cell carcinoma tissue: a role for chemokine receptors CXCR3, CXCR6, CCR5, and CCR6.
21962843 2012 Circulating interferon-?-inducible Cys-X-Cys chemokine receptor 3 ligands are elevated in humans with aortic aneurysms and Cys-X-Cys chemokine receptor 3 is necessary for aneurysm formation in mice.
21811993 2011 CXCL10 and its receptor CXCR3 regulate synovial fibroblast invasion in rheumatoid arthritis.
21739422 2011 Coexpression of chemokine receptors CCR5, CXCR3, and CCR4 and ligands for P- and E-selectin on T lymphocytes of patients with juvenile idiopathic arthritis.
21645215 2011 Serum chemokine receptor CXCR3 ligands are associated with progression, organ dysfunction and complications of chronic liver diseases.
21538345 2011 Subsets of human CD4(+) regulatory T cells express the peripheral homing receptor CXCR3.
21426802 2011 [Significance of chemokine receptor CXCR3 expression in breast cancer].
21357438 2011 Decreased CXCR3 expression in CD4+ T cells exposed to asbestos or derived from asbestos-exposed patients.
21303517 2011 Dysregulated expression of MIG/CXCL9, IP-10/CXCL10 and CXCL16 and their receptors in systemic sclerosis.
21303425 2011 Gene expression of TWEAK/Fn14 and IP-10/CXCR3 in glomerulus and tubulointerstitium of patients with lupus nephritis.
21255008 2011 Expression and agonist responsiveness of CXCR3 variants in human T lymphocytes.
21148743 2011 Reduction of CXC chemokine receptor 3 in an in vitro model of continuous exposure to asbestos in a human T-cell line, MT-2.
21091908 2011 Identification of a novel immunomodulatory gliadin peptide that causes interleukin-8 release in a chemokine receptor CXCR3-dependent manner only in patients with coeliac disease.
21087446 2011 Increased numbers of immature plasma cells in peripheral blood specifically overexpress chemokine receptor CXCR3 and CXCR4 in patients with ulcerative colitis.
21051441 2011 Chemokine receptor CXCR3 promotes growth of glioma.
20980681 2011 Angiostatic and chemotactic activities of the CXC chemokine CXCL4L1 (platelet factor-4 variant) are mediated by CXCR3.
20856926 2010 CXCL10 can inhibit endothelial cell proliferation independently of CXCR3.
20855888 2010 CXCR3-B can mediate growth-inhibitory signals in human renal cancer cells by down-regulating the expression of heme oxygenase-1.
20848514 2010 Strong overexpression of CXCR3 axis components in childhood inflammatory bowel disease.
20733031 2010 CXCR3-dependent accumulation and activation of perivascular macrophages is necessary for homeostatic arterial remodeling to hemodynamic stresses.
20529825 2010 Role of I-TAC-binding receptors CXCR3 and CXCR7 in proliferation, activation of intracellular signaling pathways and migration of various tumor cell lines.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20429924 2010 Chemokine receptor expression in tumour islets and stroma in non-small cell lung cancer.
20379873 2010 Analysis of CXCR3 and atypical variant expression and signalling in human T lymphocytes.
20377416 2010 Possible recruitment of peripheral blood CXCR3+ CD27+ CD19+ B cells to the liver of chronic hepatitis C patients.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20228225 2010 CXCR3/ligands are significantly involved in the tumorigenesis of basal cell carcinomas.
20203286 2010 Lack of CXC chemokine receptor 3 signaling leads to hypertrophic and hypercellular scarring.
20185576 2010 Roles for aberrant CXCR3 signaling in basal cell carcinoma: a case for dual activity.
20164417 2010 Distinct roles for CCR4 and CXCR3 in the recruitment and positioning of regulatory T cells in the inflamed human liver.
20096889 2010 CXCR3 binding chemokine and TNFSF14 over expression in bladder urothelium of patients with ulcerative interstitial cystitis.
20079227 2009 [The changes and significance of interleukin-16 and CXC chemokine receptor 3 expression in pulmonary artery of smokers with chronic obstructive pulmonary disease].
20059481 2010 Islet inflammation and CXCL10 in recent-onset type 1 diabetes.
20047517 2010 Relationship between CX3CR1 genetic polymorphism and carotid atherosclerosis.
20041963 2010 Potential role of CXCL10 in the induction of cell injury and mitochondrial dysfunction.
19800124 2009 Modelling of the membrane receptor CXCR3 and its complexes with CXCL9, CXCL10 and CXCL11 chemokines: putative target for new drug design.
19767105 2009 T cell extravasation: demonstration of synergy between activation of CXCR3 and the T cell receptor.
19758167 2009 CXCR3, inflammation, and autoimmune diseases.
19735481 2009 Airway smooth muscle chemokine receptor expression and function in asthma.
19734217 2009 CXCR3 mediates renal Th1 and Th17 immune response in murine lupus nephritis.
19703720 2009 Adhesion of human haematopoietic (CD34+) stem cells to human liver compartments is integrin and CD44 dependent and modulated by CXCR3 and CXCR4.
19641142 2009 Enterovirus infection, CXC chemokine ligand 10 (CXCL10), and CXCR3 circuit: a mechanism of accelerated beta-cell failure in fulminant type 1 diabetes.
19539215 2009 Recombinant human granulocyte colony-stimulating factor significantly decreases the expression of CXCR3 and CCR6 on T cells and preferentially induces T helper cells to a T helper 17 phenotype in peripheral blood harvests.
19380511 2009 CXCR3 activation by lentivirus infection suppresses neuronal autophagy: neuroprotective effects of antiretroviral therapy.
19344719 2009 Antifibrotic effects of CXCL9 and its receptor CXCR3 in livers of mice and humans.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19232748 2009 Suppression of experimental autoimmune myasthenia gravis by inhibiting the signaling between IFN-gamma inducible protein 10 (IP-10) and its receptor CXCR3.
19151743 2009 Sulfated tyrosines 27 and 29 in the N-terminus of human CXCR3 participate in binding native IP-10.
19134328 2008 [Expression and significance of chemokine CXC receptor 3, 4 and their ligands at the early pregnancy decidua and villi].
19106589 2008 [The analysis of CCR4+/CXCR3+ cell ratio in gastrointestinal cancer patients receiving chemotherapy or immunotherapy].
19017998 2008 Infiltrated neutrophils acquire novel chemokine receptor expression and chemokine responsiveness in chronic inflammatory lung diseases.
18962861 2008 A common intronic variant of CXCR3 is functionally associated with gene expression levels and the polymorphic immune cell responses to stimuli.
18832436 2008 Calcineurin inhibitors modulate CXCR3 splice variant expression and mediate renal cancer progression.
18798334 2008 Intrahepatic levels of CXCR3-associated chemokines correlate with liver inflammation and fibrosis in chronic hepatitis C.
18761554 2008 Expression of a splice variant of CXCR3 in Crohn's disease patients; indication for a lymphocyte--epithelial cell interaction.
18729739 2008 Interferon-alpha2b restores the impaired chemotactic activity of peripheral blood mononuclear cells from head and neck squamous cell carcinoma patients by modulating CXC receptor ligand interaction.
18689270 2006 The role of T helper cell subsets in pathogenesis of Systemic Lupus Erythematosus and their relation to disease activity.
18616679 2008 Significance of CXCR3 expression in gastric low-grade B-cell lymphoma of mucosa-associated lymphoid tissue type for predicting responsiveness to Helicobacter pylori eradication.
18497951 2008 Association between the expression of chemokine receptors CCR7 and CXCR3, and lymph node metastatic potential in lung adenocarcinoma.
18485912 2008 Gliadin induces an increase in intestinal permeability and zonulin release by binding to the chemokine receptor CXCR3.
18453591 2008 The chemokine receptor CXCR3 is degraded following internalization and is replenished at the cell surface by de novo synthesis of receptor.
18375741 2008 Human type II pneumocyte chemotactic responses to CXCR3 activation are mediated by splice variant A.
18291705 2008 Activation of p38(MAPK) mediates the angiostatic effect of the chemokine receptor CXCR3-B.
18280341 2008 CXCR3 <-> ligand-mediated skin inflammation in cutaneous lichenoid graft-versus-host disease.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18174362 2008 CXCL4-induced migration of activated T lymphocytes is mediated by the chemokine receptor CXCR3.
18037659 2007 Caries-related bacteria and cytokines induce CXCL10 in dental pulp.
17947699 2007 The role of IkappaB kinase 2, but not activation of NF-kappaB, in the release of CXCR3 ligands from IFN-gamma-stimulated human bronchial epithelial cells.
17912012 2007 Expression of interferon-gamma- inducible protein-10 and its receptor CXCR3 in chronic pancreatitis.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17666357 2007 [Expression of chemokine receptor CXCR3 mRNA in patients with atopic dermatitis].
17615381 2007 Expression and role of CCR6/CCL20 chemokine axis in pulmonary sarcoidosis.
17560677 2007 The role of CCR5/CXCR3 expressing CD8+ cells in liver damage and viral control during persistent hepatitis C virus infection.
17457216 Expression of CXCR3 on mononuclear cells and CXCR3 ligands in patients with metastatic renal cell carcinoma in response to systemic IL-2 therapy.
17363734 2007 Proteolytic processing of CXCL11 by CD13/aminopeptidase N impairs CXCR3 and CXCR7 binding and signaling and reduces lymphocyte and endothelial cell migration.
17339184 2007 The prognostic role of CXCR3 expression by chronic lymphocytic leukemia B cells.
17251291 2007 Modest human immunodeficiency virus coreceptor function of CXCR3 is strongly enhanced by mimicking the CXCR4 ligand binding pocket in the CXCR3 receptor.
17142784 2006 The expression and possible roles of chemokine CXCL11 and its receptor CXCR3 in the human endometrium.
17142783 2006 Cyclooxygenase regulates cell surface expression of CXCR3/1-storing granules in human CD4+ T cells.
17018607 2006 Ras-induced modulation of CXCL10 and its receptor splice variant CXCR3-B in MDA-MB-435 and MCF-7 cells: relevance for the development of human breast cancer.
16934957 2006 Overexpression of CXCL10 in human prostate LNCaP cells activates its receptor (CXCR3) expression and inhibits cell proliferation.
16930533 2006 Identification of CXCR3 receptor agonists in combinatorial small-molecule libraries.
16861617 2006 Functional and phenotypic analysis of human memory CD8+ T cells expressing CXCR3.
16847335 2006 CXCR3 requires tyrosine sulfation for ligand binding and a second extracellular loop arginine residue for ligand-induced chemotaxis.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16787707 2006 Candidate gene analysis of IP-10 gene in patients with Alzheimer's disease.
16733654 2006 Chemokine expression by astrocytes plays a role in microglia/macrophage activation and subsequent neurodegeneration in secondary progressive multiple sclerosis.
16679918 2006 Chemokine IL-8 and chemokine receptor CXCR3 and CXCR4 gene expression in childhood acute lymphoblastic leukemia at first relapse.
16456020 2006 Epithelial CXCR3-B regulates chemokines bioavailability in normal, but not in Sjogren's syndrome, salivary glands.
16455991 2006 Chemokine receptor CXCR3 desensitization by IL-16/CD4 signaling is dependent on CCR5 and intact membrane cholesterol.
16368892 2006 Role of CXCR3 carboxyl terminus and third intracellular loop in receptor-mediated migration, adhesion and internalization in response to CXCL11.
16339779 2006 CXCR3 surface expression in human airway epithelial cells: cell cycle dependence and effect on cell proliferation.
16243485 2005 Increased levels of chemokine receptor CXCR3 and chemokines IP-10 and MIG in patients with primary biliary cirrhosis and their first degree relatives.
16127166 2005 CXCR 3 activation promotes lymphocyte transendothelial migration across human hepatic endothelium under fluid flow.
16043121 2005 CXCR3 polymorphisms associated with risk of asthma.
16034118 2005 Opposing effects of CXCR3 and CCR5 deficiency on CD8+ T cell-mediated inflammation in the central nervous system of virus-infected mice.
16033640 2005 CCR2 and CXCR3 agonistic chemokines are differently expressed and regulated in human alveolar epithelial cells type II.
15885315 2005 Increased expression of CXCR3 and CCR5 on memory CD4+ T-cells migrating into the cerebrospinal fluid of patients with neuroborreliosis: the role of CXCL10 and CXCL11.
15879427 2005 The CXCL10/CXCR3 axis mediates human lung mast cell migration to asthmatic airway smooth muscle.
15856455 2005 Selective infiltration of CCR5(+)CXCR3(+) T lymphocytes in human colorectal carcinoma.
15843529 2005 Overexpression of IFN-induced protein 10 and its receptor CXCR3 in myasthenia gravis.
15808644 IP-10, apoptotic genes, and calcineurin subtype messenger RNA kinetics occurring in rat renal isografts from brain-dead donors.
15725351 2005 CXCR3/CXCL10 interactions in the development of hypersensitivity pneumonitis.
15713799 2005 Autoantigens signal through chemokine receptors: uveitis antigens induce CXCR3- and CXCR5-expressing lymphocytes and immature dendritic cells to migrate.
15687242 2005 Regulation of CXCR3 and CXCR4 expression during terminal differentiation of memory B cells into plasma cells.
15578697 2005 The Epstein-Barr virus oncoprotein latent membrane protein 1 induces expression of the chemokine IP-10: importance of mRNA half-life regulation.
15528361 2004 Identification and partial characterization of a variant of human CXCR3 generated by posttranscriptional exon skipping.
15501397 2004 Abnormal expression of chemokine receptors in Behçet's disease: relationship to intracellular Th1/Th2 cytokines and to clinical manifestations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328188 2004 CXC chemokine receptor 3 and CC chemokine receptor 4 expression in T-cell and NK-cell lymphomas with special reference to clinicopathological significance for peripheral T-cell lymphoma, unspecified.
15273303 2004 NMR structure of CXCR3 binding chemokine CXCL11 (ITAC).
15265234 2004 Effects of chemokines on proliferation and apoptosis of human mesangial cells.
15254596 2004 Regulation of pulmonary fibrosis by chemokine receptor CXCR3.
15181567 2004 Increased adhesion molecule and chemokine receptor expression on CD8+ T cells trafficking to cerebrospinal fluid in HIV-1 infection.
15155273 2004 The chemokine receptor CXCR3 and its splice variant are expressed in human airway epithelial cells.
15150261 2004 Intracellular domains of CXCR3 that mediate CXCL9, CXCL10, and CXCL11 function.
15126579 2004 Spatial and temporal expression of ligands for CXCR3 and CXCR4 in human endometrium.
14742268 2004 CXCR3 is involved in tubulointerstitial injury in human glomerulonephritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657006 2004 Allergic humans are hyporesponsive to a CXCR3 ligand-mediated Th1 immunity-promoting loop.
14630801 2004 Migration of V delta 1 and V delta 2 T cells in response to CXCR3 and CXCR4 ligands in healthy donors and HIV-1-infected patients: competition by HIV-1 Tat.
14618028 2003 Age-associated changes in functional response to CXCR3 and CXCR5 chemokine receptors in human osteoblasts.
14578618 2003 CXCR3 chemokine receptor-plasma IP10 interaction in patients with coronary artery disease.
12960302 2003 CXCR3 is induced early on the pathway of CD4+ T cell differentiation and bridges central and peripheral functions.
12960247 2003 The relative activity of CXCR3 and CCR5 ligands in T lymphocyte migration: concordant and disparate activities in vitro and in vivo.
12953097 2003 The inducible CXCR3 ligands control plasmacytoid dendritic cell responsiveness to the constitutive chemokine stromal cell-derived factor 1 (SDF-1)/CXCL12.
12919091 2003 Glomerular infiltration by CXCR3+ ICOS+ activated T cells in chronic allograft nephropathy with transplant glomerulopathy.
12884299 2003 CCR3 functional responses are regulated by both CXCR3 and its ligands CXCL9, CXCL10 and CXCL11.
12819030 2003 Infiltrating CD8+ T cells in oral lichen planus predominantly express CCR5 and CXCR3 and carry respective chemokine ligands RANTES/CCL5 and IP-10/CXCL10 in their cytolytic granules: a potential self-recruiting mechanism.
12782716 2003 An alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth induced by IP-10, Mig, and I-TAC, and acts as functional receptor for platelet factor 4.
12750173 2003 CXCR3-mediated chemotaxis of human T cells is regulated by a Gi- and phospholipase C-dependent pathway and not via activation of MEK/p44/p42 MAPK nor Akt/PI-3 kinase.
12688353 2003 Expression of chemokine receptor CXCR3 and its ligand, mig, in gastric and thyroid marginal zone lymphomas. Possible migration and autocrine mechanism.
12571234 2003 CXCR3 and heparin binding sites of the chemokine IP-10 (CXCL10).
12517959 2003 Up-regulation of early growth response gene-1 via the CXCR3 receptor induces reactive oxygen species and inhibits Na+/K+-ATPase activity in an immortalized human proximal tubule cell line.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445801 2002 The presence of chemokine (MCP-1, MIP-1alpha, MIP-1beta, IP-10, RANTES)-positive cells and chemokine receptor (CCR5, CXCR3)-positive cells in inflamed human gingival tissues.
12444109 2002 IFN-producing cells respond to CXCR3 ligands in the presence of CXCL12 and secrete inflammatory chemokines upon activation.
12425561 2002 Increased expression of T cell chemokines and their receptors in chronic hepatitis C: relationship with the histological activity of liver disease.
12356205 2002 Expression of chemokine receptors in the different clinical forms of multiple sclerosis.
12270371 2002 Mig, IP-10, and CXCR3 gene expression is predictive for the individual response of children with chronic allograft nephropathy to mycophenolate mofetil.
12097412 2002 Critical role for CXCR3 chemokine biology in the pathogenesis of bronchiolitis obliterans syndrome.
12070001 2002 Trafficking machinery of NKT cells: shared and differential chemokine receptor expression among V alpha 24(+)V beta 11(+) NKT cell subsets with distinct cytokine-producing capacity.
12055238 2002 Expression of functional CCR and CXCR chemokine receptors in podocytes.
12016104 2002 Increased expression of the chemokine receptor CXCR3 and its ligand CXCL10 in peripheral airways of smokers with chronic obstructive pulmonary disease.
11990865 2002 Selective suppression of chemokine receptor CXCR3 expression by interferon-beta1a in multiple sclerosis.
11966764 2002 Graves' disease is associated with an altered CXCR3 and CCR5 expression in thyroid-derived compared to peripheral blood lymphocytes.
11714650 2001 Expression of the chemokine receptor CXCR3 and its ligand IP-10 during human cardiac allograft rejection.
11559369 2001 Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity.
11554781 2001 Human B cell-attracting chemokine 1 (BCA-1; CXCL13) is an agonist for the human CXCR3 receptor.
11196695 2000 Single nucleotide polymorphisms in the coding regions of human CXC-chemokine receptors CXCR1, CXCR2 and CXCR3.
11160352 2001 Expression of chemokine receptors by lung T cells from normal and asthmatic subjects.
11134180 2001 Cell cycle-dependent expression of CXC chemokine receptor 3 by endothelial cells mediates angiostatic activity.
10942362 2000 CXC chemokine receptor 3 expression on CD34(+) hematopoietic progenitors from human cord blood induced by granulocyte-macrophage colony-stimulating factor: chemotaxis and adhesion induced by its ligands, interferon gamma-inducible protein 10 and monokine induced by interferon gamma.
10903763 2000 CXCR3 expression and activation of eosinophils: role of IFN-gamma-inducible protein-10 and monokine induced by IFN-gamma.
10903743 2000 IL-4 enhances keratinocyte expression of CXCR3 agonistic chemokines.
10900358 2000 Expression of the chemokine receptor CXCR3 on neurons and the elevated expression of its ligand IP-10 in reactive astrocytes: in vitro ERK1/2 activation and role in Alzheimer's disease.
10741397 2000 Human intestinal lamina propria and intraepithelial lymphocytes express receptors specific for chemokines induced by inflammation.
10666479 1999 CXC and CC chemokine receptors on coronary and brain endothelia.
10627472 2000 The chemokine receptor CXCR3 is expressed in a subset of B-cell lymphomas and is a marker of B-cell chronic lymphocytic leukemia.
10393705 1999 The chemokine receptor CXCR3 is expressed on malignant B cells and mediates chemotaxis.
10233762 1999 Human IP-9: A keratinocyte-derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3).
9660793 1998 Binding and functional properties of recombinant and endogenous CXCR3 chemokine receptors.
9625760 1998 Interferon-inducible T cell alpha chemoattractant (I-TAC): a novel non-ELR CXC chemokine with potent activity on activated T cells through selective high affinity binding to CXCR3.
9466968 1998 The chemokine receptors CXCR3 and CCR5 mark subsets of T cells associated with certain inflammatory reactions.
9419219 1998 Differential expression of chemokine receptors and chemotactic responsiveness of type 1 T helper cells (Th1s) and Th2s.
9064356 1996 Chemokine receptor specific for IP10 and mig: structure, function, and expression in activated T-lymphocytes.
8666380 1995 Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.