Property Summary

Ligand Count 380
NCBI Gene PubMed Count 316
PubMed Score 723.91
PubTator Score 462.49

Knowledge Summary

Patent (57,672)

Expression

  Differential Expression (16)

Disease log2 FC p
ulcerative colitis 2.800 4.7e-04
colon cancer 1.100 3.6e-03
cutaneous lupus erythematosus 2.200 3.4e-04
esophageal adenocarcinoma -1.400 2.6e-02
hepatocellular carcinoma 1.400 5.2e-05
lung adenocarcinoma -1.500 5.2e-19
lung cancer -2.900 2.0e-05
lung carcinoma -2.100 2.0e-13
non-small cell lung cancer -2.539 1.1e-17
osteosarcoma -3.327 5.8e-03
ovarian cancer -1.800 8.1e-09
pancreatic cancer 1.200 3.1e-03
pancreatic carcinoma 1.200 3.1e-03
psoriasis 1.700 1.1e-08
tuberculosis 1.600 6.8e-04
urothelial carcinoma -1.600 3.2e-02

Gene RIF (263)

AA Sequence

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLLGNSLVM      1 - 70
LVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACI     71 - 140
SVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRML    141 - 210
LRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQ    211 - 280
VIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVG    281 - 350
SSSGHTSTTL                                                                351 - 360
//

Text Mined References (316)

PMID Year Title