Property Summary

NCBI Gene PubMed Count 42
PubMed Score 60.29
PubTator Score 53.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -7.500 6.0e-10
posterior fossa group A ependymoma 3.700 1.8e-06
periodontitis 2.000 4.2e-25
chronic kidney disease 2.200 3.7e-02
non-small cell lung cancer 2.074 7.8e-07
intraductal papillary-mucinous adenoma (... -1.600 2.1e-02
interstitial cystitis 4.100 3.5e-05
cystic fibrosis 2.900 4.4e-05
atypical teratoid/rhabdoid tumor 2.100 5.6e-03
non primary Sjogren syndrome sicca -1.400 1.4e-02
invasive ductal carcinoma -2.310 6.2e-03
ulcerative colitis 5.400 9.2e-09
ovarian cancer -4.100 3.4e-08
psoriasis 5.100 8.4e-58

Gene RIF (26)

PMID Text
26728495 This is the first study to note that elevated systemic CCL5 and CXCL6 were associated with moderate/severe lumbar disc degeneration. These chemokines may be systemic biomarkers for the diagnosis and monitoring of disc degeneration.
25993443 The neutrophil-recruiting chemokine GCP-2/CXCL6 is expressed in cystic fibrosis airways and retains its functional properties after binding to extracellular DNA.
25323032 HIF-1alpha promotes HCC progression and metastasis by upregulating CXCL6 transcription in HCC cells.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 6 (CXCL6) in primary human brain microvascular endothelial cells
24250750 Expression of the CXCL8, CXCL6 and CXCL1 genes are under the primary control of 1,25-dihydroxyvitamin D3 and its receptor.
23814098 Data suggest that expression of CXCL6 in trophoblasts is up-regulated during pregnancy development/placentation; CXCL6 expression inhibits trophoblast cell migration and invasion by down-regulating activity of MMP2 (matrix metalloproteinase 2).
23383108 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 6 (CXCL6) in primary human brain microvascular endothelial cells
22886775 Overexpression of GCP-2 in mesenchymal stem cells has the potential to enhance their angiogenic and survival properties.
21236563 Studies show that functional blocking of GCP-2 inhibits tumor growth and metastases.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20507572 The aim of this study was to investigate the role of the transcription factors, AP-1 and NF-kappaB, in IL-6 and CXCL8 regulation in Jurkat T-cells.
20503287 Observational study of gene-disease association. (HuGE Navigator)
19369450 Report gonadotropin-releasing hormone-regulated CXCL6 expression in human placentation.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18842116 The level of expression of granulocyte chemotactic protein 2 correlates with the severity of periodontitis and appears to act as a yet unrecognized functional adjunct to interleukin-8 in pathological gingival tissues.
18782286 These observations suggest a role for CXCL6 in the innate immune response to microbial invasion of the amniotic cavity.
18563170 Observational study of gene-disease association. (HuGE Navigator)
17827342 These findings indicate that the equilibrium between angiostatic and angiogenic factors during inflammation and tumor progression is rather complex and differs depending on the chemokine, cell type, and stimulus.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17022986 LDL lipoprotein subunit L5 induces human umbilical vein endothelial cells (HUVEC) to express CXCL6.
15652347 production of GCP-2 by endothelial cells within the tumor can contribute to tumor development through neovascularization due to endothelial cell chemotaxis and to tumor cell invasion and metastasis
15214047 expression in inflamed intestinal tissue in Crohn's disease
12628493 Neutrophil recruitment to inflammatory sites is mediated by two related receptors: CXCR1 and CXCR2. Both receptors share two ligands, interleukin-8 (CXCL8) and GCP-2 (CXCL6).
12533683 induction in mesenchymal cells by interleukin-1beta and down-regulation by interferon-gamma
12524079 results suggest that granulocyte chemotactic protein-2 is an additional ELR(+)-CXC chemokine expressed in endometrial stromal cells

AA Sequence

MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFP      1 - 70
AGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN                               71 - 114
//

Text Mined References (43)

PMID Year Title
26728495 2016 Systemic blood plasma CCL5 and CXCL6: Potential biomarkers for human lumbar disc degeneration.
25993443 2016 The neutrophil-recruiting chemokine GCP-2/CXCL6 is expressed in cystic fibrosis airways and retains its functional properties after binding to extracellular DNA.
25323032 2014 HIF-1? plays a role in the chemotactic migration of hepatocarcinoma cells through the modulation of CXCL6 expression.
24250750 2013 Primary 1,25-dihydroxyvitamin D3 response of the interleukin 8 gene cluster in human monocyte- and macrophage-like cells.
23814098 2013 The chemokine CXCL6 restricts human trophoblast cell migration and invasion by suppressing MMP-2 activity in the first trimester.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22886775 2012 Mesenchymal stem cells overexpressing GCP-2 improve heart function through enhanced angiogenic properties in a myocardial infarction model.
21236563 2011 Isotypic neutralizing antibodies against mouse GCP-2/CXCL6 inhibit melanoma growth and metastasis.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20507572 2010 Differential cytokine regulation by NF-kappaB and AP-1 in Jurkat T-cells.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
19369450 2009 Gonadotropin-releasing hormone-regulated chemokine expression in human placentation.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18842116 2009 Granulocyte chemotactic protein 2 (gcp-2/cxcl6) complements interleukin-8 in periodontal disease.
18782286 2008 CXCL6 (granulocyte chemotactic protein-2): a novel chemokine involved in the innate immune response of the amniotic cavity.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18563170 2008 Modulation of cystic fibrosis lung disease by variants in interleukin-8.
18443119 2008 The human CXC chemokine granulocyte chemotactic protein 2 (GCP-2)/CXCL6 possesses membrane-disrupting properties and is antibacterial.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17827342 2007 Stimulation of angiostatic platelet factor-4 variant (CXCL4L1/PF-4var) versus inhibition of angiogenic granulocyte chemotactic protein-2 (CXCL6/GCP-2) in normal and tumoral mesenchymal cells.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17022986 2007 L5, the most electronegative subfraction of plasma LDL, induces endothelial vascular cell adhesion molecule 1 and CXC chemokines, which mediate mononuclear leukocyte adhesion.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15652347 2005 GCP-2/CXCL6 synergizes with other endothelial cell-derived chemokines in neutrophil mobilization and is associated with angiogenesis in gastrointestinal tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15214047 2004 CXCR1-binding chemokines in inflammatory bowel diseases: down-regulated IL-8/CXCL8 production by leukocytes in Crohn's disease and selective GCP-2/CXCL6 expression in inflamed intestinal tissue.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12882792 2003 Differential regulation of ENA-78 and GCP-2 gene expression in human corneal keratocytes and epithelial cells.
12628493 2003 Characterization of the molecular interactions of interleukin-8 (CXCL8), growth related oncogen alpha (CXCL1) and a non-peptide antagonist (SB 225002) with the human CXCR2.
12591113 2003 Pharmacological modulation of interleukin-17-induced GCP-2-, GRO-alpha- and interleukin-8 release in human bronchial epithelial cells.
12533683 2003 The CXC chemokine GCP-2/CXCL6 is predominantly induced in mesenchymal cells by interleukin-1beta and is down-regulated by interferon-gamma: comparison with interleukin-8/CXCL8.
12524079 2003 Secretion of granulocyte chemotactic protein-2 by cultured human endometrial stromal cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10593335 1999 Chemokine regulation of neutrophil function in surgical inflammation.
10343098 1999 Physical mapping of the CXC chemokine locus on human chromosome 4.
9692902 1998 Differential usage of the CXC chemokine receptors 1 and 2 by interleukin-8, granulocyte chemotactic protein-2 and epithelial-cell-derived neutrophil attractant-78.
9465307 1998 Localization of the human CXC chemokine subfamily on the long arm of chromosome 4 using radiation hybrids.
9164944 1997 Cloning and characterization of the human granulocyte chemotactic protein-2 gene.
9057843 1997 Cloning, bacterial expression and biological characterization of recombinant human granulocyte chemotactic protein-2 and differential expression of granulocyte chemotactic protein-2 and epithelial cell-derived neutrophil activating peptide-78 mRNAs.
8423327 1993 Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8.
8399143 1993 Human and bovine granulocyte chemotactic protein-2: complete amino acid sequence and functional characterization as chemokines.