Property Summary

NCBI Gene PubMed Count 100
PubMed Score 240.95
PubTator Score 188.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Pneumonia -1.200 4.3e-02
gastric cancer 1.900 1.1e-02
hepatocellular carcinoma 1.500 5.2e-03
pancreatic cancer 4.200 9.6e-06
malignant mesothelioma -6.800 5.2e-10
posterior fossa group A ependymoma 4.900 4.3e-13
cystic fibrosis 4.000 2.4e-06
medulloblastoma -1.200 6.4e-05
medulloblastoma, large-cell -1.100 1.7e-03
tuberculosis and treatment for 6 months -4.000 3.2e-05
non-small cell lung cancer -1.476 7.0e-04
intraductal papillary-mucinous adenoma (... 2.700 3.2e-02
intraductal papillary-mucinous neoplasm ... 5.700 1.3e-03
lung cancer -3.100 8.3e-06
colon cancer 3.400 2.7e-02
active Crohn's disease 3.979 3.5e-02
interstitial cystitis 3.500 2.5e-02
non primary Sjogren syndrome sicca -1.200 1.6e-02
pancreatic carcinoma 2.300 4.8e-03
Breast cancer -1.300 1.6e-04
ulcerative colitis 6.700 1.3e-09
chronic rhinosinusitis 2.498 1.6e-02
psoriasis 4.200 1.3e-45

Synonym

Accession P42830 Q96QE1
Symbols SCYB5
ENA-78

Gene

PDB

2MGS  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (74)

PMID Text
26287498 CXCL5 expression is enriched in human atherosclerotic coronary artery. The CXCL5 variant might be a genetic risk factor for the susceptibility of CAD and the CXCL5 promoter -156 G/C C allele might be an independent predictor for CAD.
26058729 Study shows that CXCL5 expression is elevated in positive correlation to bladder cancer grade and promotes cell migration and invasion via binding to its receptor CXCR2.
25871636 Serum levels of ENA-78 were elevated in autistic children and they were significantly associated with the increased levels of serum antineuronal auto-antibodies
25788272 There was an inverse correlation between DACH1 mRNA levels and CXCL5 in both lung cancer cell lines and human NSCLC tissues.
25738378 High CXCL5 expression is associated with pediatric ulcerative colitis.
25690483 Analysis of monocultured dermal fibroblasts and keratinocytes revealed that only fibroblasts but not keratinocytes displayed up regulated CXCL5 levels after UV stimulation.
25689618 This study aims to evaluate serum levels of ENA78/CXCL5 and SDF-1/CXCL12 along the gastric cancer carcinogenesis, and analyze their clinical significance, and diagnostic potentials through human serum samples.
25536401 the increased level of CXCL5 in tissue compartments, including the central nervous system of HIV-1-infected individuals might alter the inflammatory response through the infiltration of neutrophils into tissue compartment
25462858 our data showed that the CXCR2/CXCL5 axis contributes to EMT of HCC cells through activating PI3K/Akt/GSK-3beta/Snail signaling, and it may serve as a potential therapeutic target.
25011526 data indicates that LCCs per se may act as the producer and receptor of CXCL5 responsible for liver cancer migration and invasion
24943990 Citrullinated ENA-78/CXCL5 is highly correlated with rheumatoid arthritis disease activity and, unlike noncitrullinated ENA-78/CXCL5, recruits monocytes.
24695525 Solution structure of CXCL5--a novel chemokine and adipokine implicated in inflammation and obesity
24583128 mRNA and protein of CXCL5 is increased in bladder tumor tissues and cell lines; down-regulation of CXCL5 resulted in significantly decreased cell proliferation, migration and increased cell apoptosis through Snail, PI3K-AKT and ERK1/2 signaling pathways.
24500664 CXCL5 showed a statistically significant prognostic effect
24346967 Knockdown of HSP27 by shRNA decreased HB-EGF plus CXCL5-mediated tumor spheroid formation in a three-dimensional culture system, suggesting that AKT/HSP27 was required for HB-EGF/CXCL5-mediated cancer progression
24292093 the expression levels of CXCL5 proteins were decreased in dermal blood vessels of early stage diffuse cutaneous systemic sclerosis
23898208 HIV-1 Tat upregulates the expression of chemokine (C-X-C motif) ligand 5 (CXCL5) in human primary T cells
23469080 sCXCL5 level was determined to be an independent prognostic factor for NPC patients
23439434 Increased levels of CXCL5 contribute to enhanced levels of RANKL expression in Paget's disease of bone.
23383108 HIV-1 Tat upregulates the expression of chemokine (C-X-C motif) ligand 5 (CXCL5) in human primary T cells
23290114 Liver cancer cells with high metastatic potential have a higher expression of CXCL5. Exogenous CXCL5 can increase the proliferation, migration and invasion of liver cancer cells with low metastatic potential.
23245743 CXCL5 gene polymorphisms are functional and associated with variable blood pressure in cardiovascular disease-free individuals.
23179318 Gene expression in dendritic cells of CCL5 and CXCL5 as well as TIMP1 and GUCY1B3 showed a significant increase within the first 4 days after trauma.
22711685 CXCL5 promotes HCC cell proliferation, invasion, and intratumoral neutrophil infiltration.
22274300 Endothelial production of both ENA-78 and IL-8 was induced by the proinflammatory cytokine IL-1beta.
22197219 Preoperative serum CXCL5 could serve as a novel predictive marker for prognosis determination of colorectal cancer patients.
22125641 Data show that tumour conditioned media obtained from cultured colorectal tumour explant tissue contained high levels of the chemokines CCL2, CXCL1, CXCL5 in addition to VEGF.
21779896 Blockade of CXCL5 can modulate IL-17-induced arthritic inflammation in part by reducing joint blood vessel formation through a non-overlapping IL-17 mechanism.
21734176 Data demonstrate that the chemokine CXCL5 is a peripheral mediator of UVB-induced inflammatory pain, likely in humans as well as rats.
21609350 Serum CXC ligand 5 is a new marker of subclinical atherosclerosis in type 2 diabetes.
21332547 Plasma CXCL5 levels are lower in patients with chronic liver disease, suggesting that CXCL5 might be involved in the pathogenesis of chronic liver disease.
21229889 Report influence of troglitazone, sodium butyrate, 5-aminosalicylic acid and BAY 11-7082 on the chemokine ENA-78/CXCL5 secretion in the intestinal subepithelial myofibroblasts.
21034724 CD14 and CXCL5 were both expressed in tunica intima and tunica adventitia of adipose tissue blood vessels; CXCL5 exhibited chemoattractant and angiogenic properties.
20945384 CXCL5/ENA78 increased cell migration and epithelial-to-mesenchymal transition of hormone-independent prostate cancer by early growth response-1/snail signaling pathway.
20630876 The highly divergent effects of modifications of CXCL5 on neutrophil influx underline the potential importance of tissue-specific interactions between chemokines and PAD or proteases.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20501684 Elevated circulating CXCL5 concentrations were associated with higher risk of hypercholesterolemia in middle-aged and elderly Chinese independent of obesity, inflammation, adipokines, and other risk factors but not insulin resistance.
20137269 The 156C allele for ENA-78 may be a risk factor for idiopathic pulmonary fibrosis.
19838218 Data show that the knockdown of Ron in PC-3 or DU145 cells results in a significant decrease in angiogenic chemokine production and is associated with a decreased activation of NF-kappaB.
19724852 CXCL5 was significantly correlated with deeper depth of invasion and advanced stage of tumor but not with lymph node status in primary gastric cancer
19646363 No significant differences in allele or genotype frequencies for RANTES or ENA-78 proteins were found in patients with erythema nodosum.
19646363 Observational study of gene-disease association. (HuGE Navigator)
19567485 expression in gingival epithelial cells is induced by thrombin via activation of protease-activated receptor 1
19506876 There was a remarkably high proportion of proangiogenic factors, in particular IP10, ENA-78, and IL-8 accounting for a genetically determined susceptibility to reactive arthritis at the host cell level.
19356715 Secretion of CXCL5 by white adipose tissue resident macrophages represents a link between obesity, inflammation, and insulin resistance.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19258635 Observational study of gene-disease association. (HuGE Navigator)
19047312 Epithelial neutrophil-activating peptide-78 recruits neutrophils into pleural effusion
19035625 patients with type 2 diabetes had higher frequency of carrying the G/C or C/C genotype compared with controls; frequency of allele C was increased in patients with diabetes compared to controls; findings suggest role of CXCL5 in pathogenesis of diabetes
18769620 CXCL5/ENA-78 has a role in acute coronary syndrome and the statin response
18769620 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18570917 Results reveal that platelet-derived growth factor-B-activated fibroblasts play a key role in the recruitment/migration and differentiation of mesenchymal stem cells and implicate a bFGF- and CXCL5-dependent mechanism in mediating these effects.
18413816 Disrupted expression of CXCL5 in colorectal cancer is associated with rapid tumor formation in rats and poor prognosis in patients.
18413205 CXCL5 may be of use for telling diabetic nephropathy from primary renal diseases
18320069 CXCL5 may play multiple roles in the etiology of both benign and malignant proliferative diseases in the prostate.
17878384 unveils a proinflammatory pathway centered on kinin B1 receptor activation of CXCL5 leading to leukocyte trafficking
17761179 Stromal endometrial cells produced ENA-78 and IL-8 under cytokine stimulation.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17549409 Observational study of gene-disease association. (HuGE Navigator)
17549409 This is the first report on the influence of CXCL5 gene variants and their relation to expression of CXCL5 protein in human colorectal cancer.
17479287 CXCL5 overexpression is associated with late stage gastric cancer
17428364 lack of association of ENA-78 polymorphism with giant cell arteritis
17052298 IP-10 may play an important role in regulating lymphocytes into the lung and ENA-78 may be associated with lung parenchymal disease in pulmonary sarcoidosis.
17022986 LDL lipoprotein subunit L5 induces human umbilical vein endothelial cells (HUVEC) to express ENA-78.
16635746 The platelet-derived chemokines ENA-78 exhibited particular changes after SCT; results suggest that ENA-78 plays a role in hematopoietic conditions in which G-CSF is not involved
16574090 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
16567110 Observational study of gene-disease association. (HuGE Navigator)
16567110 CXCL5 gene polymorphisms are related to systemic concentrations and leukocyte production of epithelial neutrophil-activating peptide 78
15714497 induced by Rhinovirus infection of primary human airway fibroblasts
15021975 Peripheral blood monocytes upregulated both tumor ENA-78 and IL-8 mRNA and protein. Alveolar macrophages only upregulated ENA-78 mRNA and protein.
14967364 ENA-78 may contribute to the pathogenesis of endometriosis, possibly promoting neovascularization.
14644041 During bacterial meningitis, CXCL5 is elevated in cerebrospinal fluid, where it is involved in the recruitment of neutrophils to the central nervous system.
13679321 ENA-78 is present in increased abundance in the amniotic cavity in response to intrauterine infection and may play a role in infection-driven preterm birth and rupture of membranes secondary to leukocyte recruitment and activation.
12751040 ENA-78 is produced in bronchial epithelial cells in response to RV16 infection

AA Sequence

MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA      1 - 70
IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN                               71 - 114
//

Text Mined References (100)

PMID Year Title
26287498 2015 CXCL5 is associated with the increased risk of coronary artery disease.
26058729 2015 CXCL5/CXCR2 axis promotes bladder cancer cell migration and invasion by activating PI3K/AKT-induced upregulation of MMP2/MMP9.
25871636 2015 The possible link between elevated serum levels of epithelial cell-derived neutrophil-activating peptide-78 (ENA-78/CXCL5) and autoimmunity in autistic children.
25788272 2015 DACH1 inhibits lung adenocarcinoma invasion and tumor growth by repressing CXCL5 signaling.
25738378 2015 A microRNA signature in pediatric ulcerative colitis: deregulation of the miR-4284/CXCL5 pathway in the intestinal epithelium.
25690483 2015 UV radiation induces CXCL5 expression in human skin.
25689618 2015 Serum ENA78/CXCL5, SDF-1/CXCL12, and their combinations as potential biomarkers for prediction of the presence and distant metastasis of primary gastric cancer.
25536401 2015 Transcriptional Regulation of CXCL5 in HIV-1-Infected Macrophages and Its Functional Consequences on CNS Pathology.
25462858 2015 CXCR2/CXCL5 axis contributes to epithelial-mesenchymal transition of HCC cells through activating PI3K/Akt/GSK-3?/Snail signaling.
25011526 2014 Roles of CXCL5 on migration and invasion of liver cancer cells.
24943990 2014 Citrullination of epithelial neutrophil-activating peptide 78/CXCL5 results in conversion from a non-monocyte-recruiting chemokine to a monocyte-recruiting chemokine.
24695525 2014 Solution structure of CXCL5--a novel chemokine and adipokine implicated in inflammation and obesity.
24583128 2014 CXCL5 knockdown expression inhibits human bladder cancer T24 cells proliferation and migration.
24500664 2014 CXCL5 as a potential novel prognostic factor in early stage non-small cell lung cancer: results of a study of expression levels of 23 genes.
24346967 2014 Synergistic effect of lung tumor-associated dendritic cell-derived HB-EGF and CXCL5 on cancer progression.
24292093 2014 Fli1 deficiency contributes to the suppression of endothelial CXCL5 expression in systemic sclerosis.
23469080 2013 A novel statistical prognostic score model that includes serum CXCL5 levels and clinical classification predicts risk of disease progression and survival of nasopharyngeal carcinoma patients.
23439434 2013 CXCL5 stimulation of RANK ligand expression in Paget's disease of bone.
23290114 2012 [Expression and role of CXC chemokine 5 in liver cancer cells].
23245743 2012 CXCL5 polymorphisms are associated with variable blood pressure in cardiovascular disease-free adults.
23179318 2013 Subsequent gene expression pattern in dendritic cells following multiple trauma.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23045282 2013 Breast tumor-associated osteoblast-derived CXCL5 increases cancer progression by ERK/MSK1/Elk-1/snail signaling pathway.
22943113 2012 Potential anticancer therapies via CXCL5 and its receptors.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22711685 2012 Overexpression of CXCL5 mediates neutrophil infiltration and indicates poor prognosis for hepatocellular carcinoma.
22274300 2012 Modulatory effect of fenofibrate on endothelial production of neutrophil chemokines IL-8 and ENA-78.
22197219 2012 CXCL5, a promoter of cell proliferation, migration and invasion, is a novel serum prognostic marker in patients with colorectal cancer.
22125641 2011 Tumour tissue microenvironment can inhibit dendritic cell maturation in colorectal cancer.
21779896 2011 Anti-CXCL5 therapy ameliorates IL-17-induced arthritis by decreasing joint vascularization.
21734176 2011 CXCL5 mediates UVB irradiation-induced pain.
21609350 2011 Serum CXC ligand 5 is a new marker of subclinical atherosclerosis in type 2 diabetes.
21332547 2011 CXCL5 plasma levels decrease in patients with chronic liver disease.
21229889 Influence of troglitazone, sodium butyrate, 5-aminosalicylic acid and BAY 11-7082 on the chemokine ENA-78/CXCL5 secretion in the intestinal subepithelial myofibroblasts.
21034724 2010 Adipose tissue-derived stem cells secrete CXCL5 cytokine with chemoattractant and angiogenic properties.
20945384 2011 CXCL5/ENA78 increased cell migration and epithelial-to-mesenchymal transition of hormone-independent prostate cancer by early growth response-1/snail signaling pathway.
20630876 2010 Posttranslational modification of the NH2-terminal region of CXCL5 by proteases or peptidylarginine Deiminases (PAD) differently affects its biological activity.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20501684 2010 Elevated serum chemokine CXC ligand 5 levels are associated with hypercholesterolemia but not a worsening of insulin resistance in Chinese people.
20137269 2009 [Association of ENA-78, IP-10 and VEGF gene polymorphism with idiopathic pulmonary fibrosis].
19838218 2010 The Ron receptor tyrosine kinase positively regulates angiogenic chemokine production in prostate cancer cells.
19724852 2009 CD44v6, MMP-7 and nuclear Cdx2 are significant biomarkers for prediction of lymph node metastasis in primary gastric cancer.
19646363 Regulated upon activation normal T-cell expressed and secreted (RANTES) and epithelial cell-derived neutrophil-activating peptide (ENA-78) gene polymorphisms in patients with biopsy-proven erythema nodosum.
19567485 2010 Modulation of expression of innate immunity markers CXCL5/ENA-78 and CCL20/MIP3alpha by protease-activated receptors (PARs) in human gingival epithelial cells.
19506876 2009 Identification of candidate genes for susceptibility to reactive arthritis.
19356715 2009 CXC ligand 5 is an adipose-tissue derived factor that links obesity to insulin resistance.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19258635 2009 Association of cytokine and chemokine gene polymorphisms with severe acute respiratory syndrome.
19047312 2009 Epithelial neutrophil-activating peptide-78 recruits neutrophils into pleural effusion.
19035625 2008 CXCL5 gene polymorphism association with diabetes mellitus.
18769620 2008 Epithelial neutrophil-activating peptide (ENA-78), acute coronary syndrome prognosis, and modulatory effect of statins.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18570917 2008 A CXCL5- and bFGF-dependent effect of PDGF-B-activated fibroblasts in promoting trafficking and differentiation of bone marrow-derived mesenchymal stem cells.
18413816 2008 Disrupted expression of CXCL5 in colorectal cancer is associated with rapid tumor formation in rats and poor prognosis in patients.
18413205 Increased urinary levels of CXCL5, CXCL8 and CXCL9 in patients with Type 2 diabetic nephropathy.
18320069 2008 CXCL5 promotes prostate cancer progression.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17878384 2007 A novel inflammatory pathway involved in leukocyte recruitment: role for the kinin B1 receptor and the chemokine CXCL5.
17761179 2008 Basal and cytokine-stimulated production of epithelial neutrophil activating peptide-78 (ENA-78) and interleukin-8 (IL-8) by cultured human endometrial epithelial and stromal cells.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17549409 2007 Expression and gene polymorphisms of the chemokine CXCL5 in colorectal cancer patients.
17479287 2007 CXCL5 overexpression is associated with late stage gastric cancer.
17428364 Lack of association of epithelial cell-derived neurophil-activating peptide (ENA)-78 gene polymorphism with susceptibility to biopsy-proven giant cell arteritis.
17052298 2006 Elevated levels of interferon gamma-inducible protein-10 and epithelial neutrophil-activating peptide-78 in patients with pulmonary sarcoidosis.
17022986 2007 L5, the most electronegative subfraction of plasma LDL, induces endothelial vascular cell adhesion molecule 1 and CXC chemokines, which mediate mononuclear leukocyte adhesion.
16635746 2006 Role of platelet-derived chemokines (RANTES and ENA-78) after stem cell transplantation.
16618752 2006 Down-regulation of CXCL5 inhibits squamous carcinogenesis.
16574090 2006 Development and cross-validation of sequencing-based assays for genotyping common polymorphisms of the CXCL5 gene.
16567110 2006 CXCL5 gene polymorphisms are related to systemic concentrations and leukocyte production of epithelial neutrophil-activating peptide (ENA-78).
15714497 2005 Rhinovirus infects primary human airway fibroblasts and induces a neutrophil chemokine and a permeability factor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15021975 2004 Upregulation of bronchioloalveolar carcinoma-derived C-X-C chemokines by tumor infiltrating inflammatory cells.
14967364 2004 Peritoneal fluid concentrations of epithelial neutrophil-activating peptide-78 correlate with the severity of endometriosis.
14711052 2003 Regulation of the immune response by the interaction of chemokines and proteases.
14644041 2003 Chemotactic activity of CXCL5 in cerebrospinal fluid of children with bacterial meningitis.
13679391 2003 A high endothelial venule-expressing promiscuous chemokine receptor DARC can bind inflammatory, but not lymphoid, chemokines and is dispensable for lymphocyte homing under physiological conditions.
13679321 2004 Epithelial cell-derived neutrophil-activating peptide-78 is present in fetal membranes and amniotic fluid at increased concentrations with intra-amniotic infection and preterm delivery.
12950257 2003 Gelatinase B/MMP-9 and neutrophil collagenase/MMP-8 process the chemokines human GCP-2/CXCL6, ENA-78/CXCL5 and mouse GCP-2/LIX and modulate their physiological activities.
12751040 2003 Rhinovirus induction of the CXC chemokine epithelial-neutrophil activating peptide-78 in bronchial epithelium.
12680872 2003 Expression of the neutrophil-activating CXC chemokine ENA-78/CXCL5 by human eosinophils.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11468158 2001 Localization of distal regulatory domains in the megakaryocyte-specific platelet basic protein/platelet factor 4 gene locus.
11106948 2000 Control of chemokine production at the blood-retina barrier.
10820279 2000 Differential ability of exogenous chemotactic agents to disrupt transendothelial migration of flowing neutrophils.
10463948 1999 Novel CXCR2-dependent liver regenerative qualities of ELR-containing CXC chemokines.
10343098 1999 Physical mapping of the CXC chemokine locus on human chromosome 4.
10095777 1999 Isolation of the CXC chemokines ENA-78, GRO alpha and GRO gamma from tumor cells and leukocytes reveals NH2-terminal heterogeneity. Functional comparison of different natural isoforms.
10068592 1999 Persistent chlamydial envelope antigens in antibiotic-exposed infected cells trigger neutrophil chemotaxis.
9692902 1998 Differential usage of the CXC chemokine receptors 1 and 2 by interleukin-8, granulocyte chemotactic protein-2 and epithelial-cell-derived neutrophil attractant-78.
9365115 1997 Regulation and function of the CXC chemokine ENA-78 in monocytes and its role in disease.
9252512 1997 Enterocytes are the primary source of the chemokine ENA-78 in normal colon and ulcerative colitis.
9164944 1997 Cloning and characterization of the human granulocyte chemotactic protein-2 gene.
8702798 1996 The CXC chemokines growth-regulated oncogene (GRO) alpha, GRObeta, GROgamma, neutrophil-activating peptide-2, and epithelial cell-derived neutrophil-activating peptide-78 are potent agonists for the type B, but not the type A, human interleukin-8 receptor.
8580362 1995 Chemokine and chemokine receptor mRNA expression in human platelets.
8083342 1994 Epithelial neutrophil activating peptide-78: a novel chemotactic cytokine for neutrophils in arthritis.
7999089 1994 Characterization of the gene for human neutrophil-activating peptide 78 (ENA-78).
7929219 1994 Cloning and characterization of the human neutrophil-activating peptide (ENA-78) gene.
7828901 1994 Cloning of a full-length cDNA encoding the neutrophil-activating peptide ENA-78 from human platelets.
1744577 1991 Structure and neutrophil-activating properties of a novel inflammatory peptide (ENA-78) with homology to interleukin 8.