Property Summary

NCBI Gene PubMed Count 18
PubMed Score 21.77
PubTator Score 15.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.400 2.8e-02
intraductal papillary-mucinous carcinoma... -2.600 8.8e-04
lung carcinoma -3.900 2.7e-45
nasopharyngeal carcinoma -2.200 2.7e-05
non primary Sjogren syndrome sicca 1.200 2.8e-02
non-small cell lung cancer -1.580 1.8e-06
ovarian cancer 1.700 6.2e-05
psoriasis 3.100 7.2e-91

Gene RIF (11)

AA Sequence

MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGL      1 - 70
PKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL                          71 - 119
//

Text Mined References (23)

PMID Year Title