1. Home
  2. Targets
  3. signaling molecule
  4. cytokine
  5. chemokine
  6. C-X-C motif chemokine 16

Tbio C-X-C motif chemokine 16

Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo.

 Comments

Property Summary

NCBI Gene PubMed Count 121
PubMed Score 154.13
PubTator Score 170.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Atherosclerosis 275 3.542 1.8

Expression

  Differential Expression (15)

Disease log2 FC p
glioblastoma 1.800 1.9e-04
osteosarcoma -1.273 4.2e-02
primary pancreatic ductal adenocarcinoma 1.443 2.7e-02
tuberculosis -1.900 1.9e-04
non-small cell lung cancer -1.452 1.1e-14
intraductal papillary-mucinous carcinoma... 2.200 4.3e-03
intraductal papillary-mucinous neoplasm ... 2.400 1.0e-02
active ulcerative colitis 2.452 3.3e-03
pediatric high grade glioma 1.500 1.2e-04
group 3 medulloblastoma -1.100 1.8e-02
pilocytic astrocytoma 1.900 1.9e-08
posterior fossa group A ependymoma 1.300 1.4e-07
lung carcinoma -2.500 9.5e-18
ovarian cancer 2.700 3.8e-07
pancreatic cancer 1.600 1.8e-02

Synonym

Accession Q9H2A7 A0N0N4 A8K7U9 B2RCB0 Q8TC80 Q96K63 Q9BXD6 Q9H2F6
Symbols SRPSOX
CXCLG16
SR-PSOX

Gene

CXCL16

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (13)

See all...

 GO Function (3)

 GO Component (5)

 GO Process (9)

 Compartment GO Term (19)

See all...

 MGI Phenotype (4)

 HCA RNA Cell Line (55)

See all...

 CSPA Cell Line (12)

See all...

Pathway (13)

See all...

Protein-protein Interaction (65)

GNAT3   S1PR2   S1PR4   PPBP   APP   SAA1   ADORA3   CXCL8   ADRA2C   CXCR5   CCR2   CXCL12   CXCR3   CCR9   CCL23   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CXCR4   NMS   PIK3R6   TAS2R42   MT-RNR2   NPW   NPB   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   ARHGEF1   MCHR2   OXGR1   P2RY13   SUCNR1   HCAR1   NMUR2   LPAR5   S1PR5   NMUR1   HEBP1   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   GPR55  

Gene RIF (116)

PMID Text
26796342 Cell proliferation enhancing and anti-apoptosis activity requires the intracellular domain and apparently the dimerization of the transmembrane chemokine ligand.
26708384 Wnt5a-Ror2 signaling enhances expression and secretion of CXCL16 in mesenchymal stem cells thereby activating CXCR6 expressed on tumor cells to promote proliferation.
26707275 Our data suggest that CXCL16 induces angiogenesis in autocrine manner via ERK, Akt, p38 pathways and HIF-1alpha modulation
26621504 In conclusion, rheumatoid arthritis synovial fibroblasts were activated by CXCL16 to produce RANKL via pathways involving JAK2/STAT3 and p38/MAPK
26345917 HMGB-1, CXCL16, miRNA-30a, and urinary TGF-ss1 were highly expressed in PNS patients and may play important roles in the pathogenesis and development of PNS.
26272362 high protein expression of CXCL16 and high protein co-expression of CXCL16/CXCR6 in prostate cancer were independent predictors for a worse clinical outcome
26058873 These results indicate that MEK inhibitor diminishes Nasopharyngeal carcinoma cell proliferation and NPC-induced osteoclastogenesis via modulating CCL2 and CXCL16 expressions.
26045830 PPARG rs1152002, AGTR1 rs5186, CXCL16 rs3744700 and LGALS2 rs7291467 polymorphisms may be closely related to the development of coronary heart disease
26021984 we examined the expression of CXCL16 and CXCR6 and their relations to prognosis in 335 unselected patients with NSCLC, and investigated possible relationships with our previously studied immunologic and angiogenic markers
25904061 Endothelial CXCL16's action on platelets is not limited to platelet activation. Immobilised CXCL16 also acts as a potent novel platelet adhesion ligand, inducing platelet adhesion to the human vessel wall.
25661686 Serum CXCL16 is increased in severe pancreatitis with infected pancreatic necrosis and identifies patients who benefit from surgical necrosectomy
25391425 Silencing CXCL16 could phenocopy the effects of miR-451 on phenotypes of osteosarcoma cells.
25372401 injured hepatocytes up-regulated CXCL16 expression, indicating that scavenging functions of CXCL16 might be additionally involved in the pathogenesis of NAFLD.
25223819 CXCL16 expression is enhanced in inflammatory cardiomyopathy and is an independent predictor of death in patients with heart failure.
25142184 CXCL16 T123V181 haplotype is a moderate genetic risk factor for the development of carotid plaque.
25015061 Elevated serum sCXCL16 levels were discovered in the systemic lupus erythematosus patients with cutaneous and renal involvement.
24897301 CXCL16 and CXCR6 coexpression is associated with invasiveness of lung cancer.
24861945 High circulating CXCL16 levels are associated to human kidney and cardiovascular disease and urinary CXCL16 may increase in kidney injury.
24854635 No significant association of the CXCL16 polymorphism was established either with soluble CXCL16 plasma levels or with clinical parameters and course of multiple sclerosis.
24518602 High serum sCXCL16 is a prognostic marker for poor survival of OC patients, possibly reflecting ADAM-10 and ADAM-17 pro-metastatic activity.
24513807 CXCL16, iNKT cell-associated cell marker Valpha24, and CD1d were significantly upregulated in esophageal biopsies from EoE patients and correlated with the expression of inflammatory mediators associated with allergy.
24507753 Our results suggest that the CXCL16/CXCR6 axis appears to be important in the progression of Ewing sarcoma family tumor
24489966 Serum CXCL16 may be an indicator of renal injury in subjects with type 2 diabetes mellitus.
24460887 Serum CXCL16 was increased in patients with active Primary nephrotic syndrome and correlated with blood lipids, urine protein and immune and inflammation responses
24302814 CXCL16/CXCR6 interaction may play an important role in modifying the response of pDCs to environmental danger signals
24284794 Erythrocyte adhesion to immobilized platelets requires phosphatidylserine at the erythrocyte surface and CXCL16 as well as CD36 expression on platelets.
24162774 HIV-1 gp120 upregulates the expression of chemokine (C-X-C motif) ligand 16 (CXCL16) in human B cells
24069377 CXCL16 could be a novel biomarker and potential predictor of disease activity in MS.
24064021 Suggest that expression of transmembrane CXCL16 on surface of plasmacytoid dendritic cell might contribute to high serum IFN-alpha levels seen in patients with Behcet's disease.
23743627 CXCL16, inversely correlated with CD99 expression in Hodgkin Reed-Sternberg (H/RS) cells.
23633118 These results indicate that CXCL16 and its receptor CXCR6 may be a central ligand/receptor pair that is closely associated with EPC recruitment and blood vessel formation in the rheumatoid arthritis joint.
23628207 CXCL16 is highly expressed by glial tumor and stroma cells whereas CXCR6 defines a subset of cells with stem cell character.
23428418 This data indicates that human P2X7 activation induces the rapid shedding of CXCL16 and that this process involves ADAM10.
23398954 Data suggest that plasma level of CXCL16 is up-regulated in subjects with metabolic syndrome and correlates with severity of carotid atherosclerosis (i.e., intima-media thickness and plaque index).
23229614 CXCL16 was found to be abundantly expressed in human meningioma samples of different malignant grades.
23009930 study revealed some conformational motifs of basic amino acid residues, especially R76 with K79 in SR-PSOX, may form a common functional motif for its critical functions; R78 in SR-PSOX has the potential action to stabilize the function of oxLDL uptake and bacterial phagocytosis
22863086 The expression and serum concentration of CXC chemokine ligand 16 could indicate the aggressiveness and prognosis of gastric carcinomas.
22627199 CXCL16 levels are significantly increased in gout patients with and without chronic kidney disease, and are independently associated with renal function.
22454615 data suggest that expression levels of a surface receptor, namely, CXCL16, correlate with B cell responses mediated by TLR9 in common variable immunodeficiency
22378888 CXCL16 mediates cross talk between astrocytes and neighboring neurons and in pathological conditions counteracts neuronal cell death.
22278019 TWEAK upregulates the expression of the chemokine CXCL16 in tubular epithelium and this may contribute to kidney tubulointerstitial inflammation.
22113484 The results indicated that CXCL16-CXCR6 interactions mediate homing of CD8+ T cells into human skin, and thereby contribute to psoriasis pathogenesis.
22055341 An increase in plasma CXCL16 during the first days after the initial event is associated with an adverse outcome in patients with acute ischemic stroke.
21845497 Soluble CXCL16 may play an important role in liver metastases through the induction of epithelial-mesenchymal transition.
21773780 CXCL16 and CXCR6 might be involved in the pathophysiology of endometriosis through regulation of the inflammatory response.
21638128 is associated with Henoch-Schonlein purpura
21612780 Suggest that CXCL16 may promote the adhesion of monocytes to the endothelium during early atherogenesis and that accumulating cytokines enhance CXCL16-mediated adhesion by upregulating CXCL16 expression.
21527066 The expressions of CXCL12/CXCR4 and CXCL16/CXCR6 were significantly higher in epithelial ovarian carcinomas than in normal epithelial ovarian tissues or benign epithelial ovarian tumors.
21505717 enhanced platelet expression in patients with acute coronary syndrome compared to patients with stable angina
21492481 These findings suggest that mutagenesis of the basic amino acids in the chemokine domain of SR-PSOX may contribute to atherogenesis.
21471570 SR-PSOX/CXCL16 plays a critical role in colonic inflammation and could be a potential therapeutic target for patients with inflammatory bowel diseases.
21468586 High CXCL16/CXCR6 expression may be related to aggressive cancer behavior, and high CXCL16 expression to bone metastases.
21467783 Plasma level of CXCL16 is an independent predictor of the prognosis of the patients with intermediate coronary lesions.
21303517 CXCL16 and CXCR6 are elevated in Systemic sclerosis (SSc) serum and on SSc dermal Endothelial cells, respectively
21233446 The CXCL16 A181V mutation selectively inhibits monocyte adhesion to CXCR6 but is not associated with human coronary heart disease.
20960183 The co-localization of SARS-CoVN and CXCL16 in the cytoplasm of HEK293FT cells was also shown using confocal laser scanning microscopy.
20848509 CXCL16 mRNA and protein expression is up-regulated in intestinal inflammation in vitro and in Crohn's disease patients, suggesting an important role for this chemokine in intestinal inflammation.
20646641 No CXCL16 protein was detected in clinical prostate cancer samples. CXCL16 could promote the in vitro migration and invasion of PC3 and LNCap cell lines.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20621591 Serum CXCL16 concentration is significantly associated with atherosclerotic stroke and carotid atherosclerosis
20621591 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20334513 Overall, our data indicate that up-regulation of CXCL16 is a common response of tumor cells to radiation, and they have important implications for the use of local radiotherapy in combination with immunotherapy.
19954776 SNP rs3744700 of CXCL16 gene is independently associated with the development of CAD in Chinese Han population, and GG homozygote which is associated with increased expression of CXCL16 may have a promoting effect on CAD.
19954776 Observational study of gene-disease association. (HuGE Navigator)
19919988 Report increased production of CXCL16 in clinical heart failure: a possible role in extracellular matrix remodeling.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19729872 sSR-PSOX/CXCL16 is a biomarker for acute coronary syndrome, which would provide additional diagnostic information besides TnT and sLOX-1
19690611 data suggest that CXCL16 and CXCR6 may mark cancers arising in an inflammatory milieu and mediate pro-tumorigenic effects of inflammation through effects on cancer cell growth and by inducing the migration and proliferation of tumor-associated leukocytes
19674076 Our findings suggest a complex interaction between CXCL16 and HIV, promoting both inflammatory and anti-inflammatory effects as well as HIV replication, partly dependent on accompanying HIV replication.
19674076 HIV-1 gp120 upregulates the expression of chemokine (C-X-C motif) ligand 16 (CXCL16) in human B cells
19605674 CXCL16 levels were increased in patients with systemic sclerosis, and correlated with the extent of skin sclerosis, suggesting that CXCL16 may have a role in the development of skin fibrosis in systemic sclerosis.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19575365 Myofibroblastic hepatic stellate cells release soluble Hedgehog ligands that stimulate cholangiocytes to produce Cxcl16 and recruit NKT cells.
19528340 In patients with an acute coronary syndrome, CXCL16 levels obtained within 24 hours of admission are associated with long-term mortality after adjustment for other risk factors
19494317 CXCL16 mediates atheroprotection through its scavenger role in macrophages and not by cell-cell adhesion
19435795 we presume important roles for CXCL16, ADAM10, and ADAM17 in the development of membranous nephropathy
19426159 regulation of CXCL16, ADAM10 and oxLDL expression may be an early event in the onset of diabetic nephropathy
19415545 bronchial epithelial cells secreted relatively high basal levels of CXCL16, chemotactic for CXCR6 expressing T cells from blood
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19070478 data demonstrate that downregulation of CXCL16 plays an important role in renal cancer development and progression, and that CXCL16 in renal cell carcinoma is an independent prognostic marker for better patient survival
18760678 CXCR6 and CXCR3 act coordinately with respective ligands and are involved in the pathophysiology of Juvenile Idiopathic Arthritis-associated inflammatory processes.
18636150 CXCL16 seems to play an important role in the pathobiology of pancreatic cancer
18565283 sirna decreased the expression of the SRPSOX gene by inhibiting macrophage-derived foam cell formation
18514099 CXCL16 levels in the acute coronary syndrome group were higher than controls and stable angina pectoris group
18480749 CXCL16 and ADAM10 are involved in the recruitment of T cells to the kidney
18373975 The regulation and functional role of CXCL16 in human mesangial cells was studied.
18344492 CXCL16 functions, through CXCR6, as a novel chemotactic factor for prostate cancer cells.
18339644 Soluble CXCL16 could be linked to atherogenesis not only as a marker of inflammation, but also as a potential inflammatory mediator.
18293410 CXCL16 appears to be a novel growth factor for schwannomas of different localization.
18279707 Increased level of serum-soluble CXCL16 was independently associated with acute coronary syndromes
18250446 Functions as one of the factors in trophoblast-conditioned culture medium that interacts with CXCR6 and recruits and maintains monocytes, T cells, and gammadelta T cells residing in human decidua.
18248772 in Crohn's disease (CD), the CXCL16 p.Ala181Val polymorphism is not a disease susceptibility gene but associated with younger age at disease onset and higher frequency of ileal involvement
18248772 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18195710 Re-expression of CXCL16 reduced growth of an RCC cell line in vitro.
18194461 Hyperhomocysteinemia up-regulates CXCL16 leading to increased recruitment of CXCR6(+) lymphocytes and scavenging of modified lipids via a potential involvement of a PPAR-gamma-dependent mechanism
17855433 The CXCL16 is a novel mediator of the innate immune reactivities of epidermal keratinocytes.
17803654 Bacterial infection causes the upregulation of CXCL16 in gallbladder epithelia, leading to the chemoattraction of macrophages via CXCL16-CXCR6 interaction and formation of the characteristic histology of xanthogranulomatous cholecystitis.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17363916 CXCL16 is constitutively expressed on the surface of human epidermal keratinocytes, released upon cell activation or photodamage and may then target CXCR6-expressing T cells in the dermis
17300746 evaluate the contribution of soluble CXCL16 to the scavenging of oxLDL and its potential as a marker for cardiovascular disease in patients with rheumatoid arthritis
16849465 The membrane-bound scavenger receptor CXCL16 expressed on the surface of plasmacytoid dendritic cells contributes to the binding, uptake, and stimulatory activity of D class CpG oligonucleotides.
16431903 CXCL16 plays important roles in human extravillous cytotrophoblast invasion and placentation.
16200580 CXCL16 plays an important role in T cell accumulation and stimulation in rheumatoid arthritis synovium
16142401 Findings suggest that retinoid signaling might be a pathway modulating inflammatory response by regulating CXCL16 expression in a cell-specific manner.
15934948 Transmembrane chemokine CXCL16 is expressed in the brain by malignant and inflamed astroglial cells, shed to a soluble form and targets not only activated T cells but also glial cells themselves.
15883016 CXCL16 may act as a novel angiogenic factor for HUVEC and that ERK is involved as an important signaling molecule to mediate its angiogenic effects
15836657 Observational study of gene-disease association. (HuGE Navigator)
15634930 CXCL16 promotes lymphocyte adhesion to epithelial cells and may function to attract and retain effector cells that support biliary and hepatocyte destruction in inflammatory liver disease.
15555552 Smooth muscle cells express CXCL16 in atherosclerotic lesions, which may play a role in the attraction of T cells to atherosclerotic lesions and contribute to the cellular internalisation of modified LDL.
15128827 This report demonstrates that CXCL16 is a novel substrate for a disintegrin and metalloproteinase domain (ADAM)10-mediated ectodomain shedding.
14988089 This chemokine/scavenger receptor could serve as a molecular link between lipid metabolism and immune activity in the atherosclerotic lesion.
14699018 SR-PSOX/CXCL16 may be involved in CD8+ T cell recruitment through VLA-4 activation and stimulation of IFN-[gamma] production by CD8+ T cells during inflammatory valvular heart disease.
14634054 SR-PSOX/CXCL16 is a unique molecule that not only attracts T cells and NKT cells toward DCs but also supports their firm adhesion to DCs.
14625285 CXCL16 may play an important role in the development and progression of atherosclerotic vascular disease
12902461 SR-PSOX/CXCL16 may play an important role in facilitating uptake of various pathogens and chemotaxis of T and NKT cells by antigen presenting cells through its chemokine domain.

AA Sequence 

MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLY      1 - 70
YTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQM     71 - 140
LLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLC    141 - 210
LLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT                              211 - 254
//

Text Mined References (121)

PMID Year Title
26796342 2016 Transmembrane chemokines act as receptors in a novel mechanism termed inverse signaling.
26708384 2016 Wnt5a-Ror2 signaling in mesenchymal stem cells promotes proliferation of gastric cancer cells by activating CXCL16-CXCR6 axis.
26707275 2016 CXCL16 induces angiogenesis in autocrine signaling pathway involving hypoxia-inducible factor 1? in human umbilical vein endothelial cells.
26621504 2016 CXCL16 upregulates RANKL expression in rheumatoid arthritis synovial fibroblasts through the JAK2/STAT3 and p38/MAPK signaling pathway.
26345917 2015 Analysis of the expression of HMGB-1, CXCL16, miRNA-30a, and TGF-?1 in primary nephritic syndrome patients and its significance.
26272362 2015 The prognostic significance of CXCL16 and its receptor C-X-C chemokine receptor 6 in prostate cancer.
26058873 2015 MEK inhibitor diminishes nasopharyngeal carcinoma (NPC) cell growth and NPC-induced osteoclastogenesis via modulating CCL2 and CXCL16 expressions.
26045830 2015 PPARG, AGTR1, CXCL16 and LGALS2 polymorphisms are correlated with the risk for coronary heart disease.
26021984 2015 Prognostic impact of CXCL16 and CXCR6 in non-small cell lung cancer: combined high CXCL16 expression in tumor stroma and cancer cells yields improved survival.
25904061 2015 Platelets from flowing blood attach to the inflammatory chemokine CXCL16 expressed in the endothelium of the human vessel wall.
25661686 The chemokine ligand CXCL16 is an indicator of bacterial infection in necrotizing pancreatitis.
25391425 2015 MiR-451 inhibits cell growth and invasion by targeting CXCL16 and is associated with prognosis of osteosarcoma patients.
25372401 2014 Pharmacological inhibition of the chemokine CXCL16 diminishes liver macrophage infiltration and steatohepatitis in chronic hepatic injury.
25223819 2014 CXCL16 is a novel diagnostic marker and predictor of mortality in inflammatory cardiomyopathy and heart failure.
25142184 2015 CXCL16 haplotypes in patients with human carotid atherosclerosis: preliminary results.
25015061 2014 Elevated levels of serum sCXCL16 in systemic lupus erythematosus; potential involvement in cutaneous and renal manifestations.
24897301 2014 CXCL16 and CXCR6 are coexpressed in human lung cancer in vivo and mediate the invasion of lung cancer cell lines in vitro.
24861945 2014 CXCL16 in kidney and cardiovascular injury.
24854635 2014 The gender-specific association of CXCL16 A181V gene polymorphism with susceptibility to multiple sclerosis, and its effects on PBMC mRNA and plasma soluble CXCL16 levels: preliminary findings.
24518602 2014 Elevated serum CXCL16 is an independent predictor of poor survival in ovarian cancer and may reflect pro-metastatic ADAM protease activity.
24513807 2014 Involvement of the iNKT cell pathway is associated with early-onset eosinophilic esophagitis and response to allergen avoidance therapy.
24507753 2014 CXCL16 and CXCR6 in Ewing sarcoma family tumor.
24489966 2014 Serum CXCL16 as a novel marker of renal injury in type 2 diabetes mellitus.
24460887 2014 Increased serum CXCL16 is highly correlated with blood lipids, urine protein and immune reaction in children with active nephrotic syndrome.
24302814 2013 Plasmacytoid dendritic cell response to CpG ODN correlates with CXCL16 expression and is inhibited by ox-LDL.
24284794 2014 Dynamic adhesion of eryptotic erythrocytes to immobilized platelets via platelet phosphatidylserine receptors.
24069377 2013 Inflammation markers in multiple sclerosis: CXCL16 reflects and may also predict disease activity.
24064021 The expression of transmembrane and soluble CXCL16 and the relation with interferon-alpha secretion in patients with Behçet's disease.
23743627 2013 CXC chemokine ligand 16, inversely correlated with CD99 expression in Hodgkin Reed-Sternberg cells, is widely expressed in diverse types of lymphomas.
23633118 2013 Evidence that CXCL16 is a potent mediator of angiogenesis and is involved in endothelial progenitor cell chemotaxis : studies in mice with K/BxN serum-induced arthritis.
23628207 2013 The CXCL16-CXCR6 chemokine axis in glial tumors.
23428418 2013 Human P2X7 receptor activation induces the rapid shedding of CXCL16.
23398954 2013 Associations of CXCL16/CXCR6 with carotid atherosclerosis in patients with metabolic syndrome.
23229614 2013 The transmembrane chemokines CXCL16 and CX3CL1 and their receptors are expressed in human meningiomas.
23009930 2013 Modification of SR-PSOX functions by multi-point mutations of basic amino acid residues.
22863086 2012 Role and clinicopathologic significance of CXC chemokine ligand 16 and chemokine (C-X-C motif) receptor 6 expression in gastric carcinomas.
22627199 2012 Soluble C-X-C chemokine ligand 16 levels are increased in gout patients.
22454615 2012 B cell responses to CpG correlate with CXCL16 expression levels in common variable immunodeficiency.
22378888 2012 CXCL16 orchestrates adenosine A3 receptor and MCP-1/CCL2 activity to protect neurons from excitotoxic cell death in the CNS.
22278019 2012 TWEAK (tumor necrosis factor-like weak inducer of apoptosis) activates CXCL16 expression during renal tubulointerstitial inflammation.
22113484 2012 CXCL16 and CXCR6 are upregulated in psoriasis and mediate cutaneous recruitment of human CD8+ T cells.
22055341 2012 Soluble CXCL16 and long-term outcome in acute ischemic stroke.
21845497 2012 Soluble CXCL16 in preoperative serum is a novel prognostic marker and predicts recurrence of liver metastases in colorectal cancer patients.
21773780 2011 Expression and localization of CXCL16 and CXCR6 in ovarian endometriotic tissues.
21638128 2011 CCL5, CXCL16, and CX3CL1 are associated with Henoch-Schonlein purpura.
21612780 2011 SR-PSOX at sites predisposed to atherosclerotic lesion formation mediates monocyte-endothelial cell adhesion.
21527066 2011 Chemokine axes CXCL12/CXCR4 and CXCL16/CXCR6 correlate with lymph node metastasis in epithelial ovarian carcinoma.
21505717 2011 CXCL16 is a novel scavenger receptor on platelets and is associated with acute coronary syndrome.
21492481 2011 Function modification of SR-PSOX by point mutations of basic amino acids.
21471570 2011 SR-PSOX/CXCL16 plays a critical role in the progression of colonic inflammation.
21468586 Clinical significance of CXCL16/CXCR6 expression in patients with prostate cancer.
21467783 2011 CXC chemokine ligand 16 as a prognostic marker in patients with intermediate coronary artery lesions: a 2-year follow-up study.
21303517 2011 Dysregulated expression of MIG/CXCL9, IP-10/CXCL10 and CXCL16 and their receptors in systemic sclerosis.
21233446 2011 The CXCL16 A181V mutation selectively inhibits monocyte adhesion to CXCR6 but is not associated with human coronary heart disease.
20960183 2010 Cxcl16 interact with SARS-CoV N protein in and out cell.
20848509 2010 Expression and regulation of the chemokine CXCL16 in Crohn's disease and models of intestinal inflammation.
20646641 2010 [Role of CXCL16/CXCR6 axis in the metastasis of human prostate cancer].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20621591 2010 Chemokine CXC Ligand 16 serum concentration but not A181V genotype is associated with atherosclerotic stroke.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20334513 2010 Up-regulation of the pro-inflammatory chemokine CXCL16 is a common response of tumor cells to ionizing radiation.
19954776 2010 An intron polymorphism in the CXCL16 gene is associated with increased risk of coronary artery disease in Chinese Han population: a large angiography-based study.
19919988 2009 Increased production of CXCL16 in experimental and clinical heart failure: a possible role in extracellular matrix remodeling.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19729872 2009 Circulating soluble SR-PSOX/CXCL16 as a biomarker for acute coronary syndrome -comparison with high-sensitivity C-reactive protein.
19690611 2009 The chemokine CXCL16 and its receptor, CXCR6, as markers and promoters of inflammation-associated cancers.
19674076 2009 CXCL16 in HIV infection - a link between inflammation and viral replication.
19605674 2009 Serum CXCL16 concentrations correlate with the extent of skin sclerosis in patients with systemic sclerosis.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19575365 2009 Repair-related activation of hedgehog signaling promotes cholangiocyte chemokine production.
19528340 2009 Soluble CXCL16 predicts long-term mortality in acute coronary syndromes.
19494317 2009 Atherogenic lipids induce high-density lipoprotein uptake and cholesterol efflux in human macrophages by up-regulating transmembrane chemokine CXCL16 without engaging CXCL16-dependent cell adhesion.
19435795 2009 CXCL16 is expressed in podocytes and acts as a scavenger receptor for oxidized low-density lipoprotein.
19426159 2009 CXCL16 and oxLDL are induced in the onset of diabetic nephropathy.
19415545 2009 The chemokine CXCL16 is highly and constitutively expressed by human bronchial epithelial cells.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19070478 2009 Tumoural CXCL16 expression is a novel prognostic marker of longer survival times in renal cell cancer patients.
18760678 2008 CXCR6-CXCL16 interaction in the pathogenesis of Juvenile Idiopathic Arthritis.
18636150 2008 Expression and potential function of the CXC chemokine CXCL16 in pancreatic ductal adenocarcinoma.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18565283 2008 Lentiviral vector-mediated siRNA knockdown of SR-PSOX inhibits foam cell formation in vitro.
18514099 2008 Circulating CXCL16 is related to the severity of coronary artery stenosis.
18480749 2008 Characterization of CXCL16 and ADAM10 in the normal and transplanted kidney.
18373975 2008 The role of CXCL16 and its processing metalloproteinases ADAM10 and ADAM17 in the proliferation and migration of human mesangial cells.
18344492 2008 CXCL16 functions as a novel chemotactic factor for prostate cancer cells in vitro.
18339644 2008 High levels and inflammatory effects of soluble CXC ligand 16 (CXCL16) in coronary artery disease: down-regulatory effects of statins.
18293410 2008 Overexpression of CXCL16 and its receptor CXCR6/Bonzo promotes growth of human schwannomas.
18279707 2008 Increased serum CXCL16 level is a marker for acute coronary syndromes.
18250446 2008 Human trophoblasts recruited T lymphocytes and monocytes into decidua by secretion of chemokine CXCL16 and interaction with CXCR6 in the first-trimester pregnancy.
18248772 2008 Genotype-phenotype analysis of the CXCL16 p.Ala181Val polymorphism in inflammatory bowel disease.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18195710 2008 Functional epigenomics approach to identify methylated candidate tumour suppressor genes in renal cell carcinoma.
18194461 Homocysteine up-regulates vascular transmembrane chemokine CXCL16 and induces CXCR6+ lymphocyte recruitment in vitro and in vivo.
17855433 2007 CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes.
17803654 2007 Involvement of Escherichia coli in pathogenesis of xanthogranulomatous cholecystitis with scavenger receptor class A and CXCL16-CXCR6 interaction.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17363916 2007 Constitutive expression and regulated release of the transmembrane chemokine CXCL16 in human and murine skin.
17300746 2007 Circulating CXCL16 is not related to circulating oxLDL in patients with rheumatoid arthritis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16849465 2006 CXCL16 influences the nature and specificity of CpG-induced immune activation.
16431903 2006 Chemokine CXCL16, a scavenger receptor, induces proliferation and invasion of first-trimester human trophoblast cells in an autocrine manner.
16200580 2005 Pathogenic role of the CXCL16-CXCR6 pathway in rheumatoid arthritis.
16142401 2005 All-trans retinoic acid regulates CXCL16/SR-PSOX expression.
15934948 2005 Enhanced expression and shedding of the transmembrane chemokine CXCL16 by reactive astrocytes and glioma cells.
15883016 2005 CXCL16 is a novel angiogenic factor for human umbilical vein endothelial cells.
15836657 2005 Severity of coronary artery stenosis is associated with a polymorphism in the CXCL16/SR-PSOX gene.
15634930 2005 CXC chemokine ligand 16 promotes integrin-mediated adhesion of liver-infiltrating lymphocytes to cholangiocytes and hepatocytes within the inflamed human liver.
15555552 2004 The chemokine and scavenger receptor CXCL16/SR-PSOX is expressed in human vascular smooth muscle cells and is induced by interferon gamma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128827 2004 The transmembrane CXC-chemokine ligand 16 is induced by IFN-gamma and TNF-alpha and shed by the activity of the disintegrin-like metalloproteinase ADAM10.
14988089 2004 CXCL16/SR-PSOX is an interferon-gamma-regulated chemokine and scavenger receptor expressed in atherosclerotic lesions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699018 2004 Upregulation of SR-PSOX/CXCL16 and recruitment of CD8+ T cells in cardiac valves during inflammatory valvular heart disease.
14634054 2004 Cell surface-anchored SR-PSOX/CXC chemokine ligand 16 mediates firm adhesion of CXC chemokine receptor 6-expressing cells.
14625285 2004 CXCL16 signals via Gi, phosphatidylinositol 3-kinase, Akt, I kappa B kinase, and nuclear factor-kappa B and induces cell-cell adhesion and aortic smooth muscle cell proliferation.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12902461 2003 Cutting edge: SR-PSOX/CXC chemokine ligand 16 mediates bacterial phagocytosis by APCs through its chemokine domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11290797 2001 Expression cloning of the STRL33/BONZO/TYMSTRligand reveals elements of CC, CXC, and CX3C chemokines.
11060282 2000 Molecular cloning of a novel scavenger receptor for oxidized low density lipoprotein, SR-PSOX, on macrophages.
11017100 2000 A transmembrane CXC chemokine is a ligand for HIV-coreceptor Bonzo.