Property Summary

NCBI Gene PubMed Count 77
PubMed Score 260.01
PubTator Score 86.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Contact Dermatitis 81

Expression

  Differential Expression (31)

Disease log2 FC p
adult high grade glioma -2.100 4.3e-02
astrocytic glioma -3.000 6.7e-03
Astrocytoma, Pilocytic -3.200 3.9e-04
atypical teratoid / rhabdoid tumor -3.800 1.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.360 1.7e-02
Breast cancer 2.800 2.5e-02
breast carcinoma -2.200 3.4e-19
colon cancer -1.200 4.9e-02
cutaneous lupus erythematosus -1.500 2.5e-03
cystic fibrosis 1.600 4.5e-02
Down syndrome -1.200 2.1e-02
Duchenne muscular dystrophy 1.866 7.2e-06
ductal carcinoma in situ -1.200 5.4e-03
ependymoma -4.400 2.6e-03
gastric carcinoma 1.300 3.8e-02
glioblastoma -1.900 2.3e-02
group 3 medulloblastoma -2.900 4.2e-02
interstitial lung disease 2.900 3.9e-02
invasive ductal carcinoma -3.300 1.5e-03
limb girdle muscular dystrophy 2A 1.573 7.5e-04
lung adenocarcinoma 1.100 3.8e-04
lung cancer 3.300 6.2e-06
medulloblastoma, large-cell -5.900 1.6e-04
nasopharyngeal carcinoma -1.700 3.4e-02
non-small cell lung cancer 3.823 2.1e-13
oligodendroglioma -2.800 9.1e-03
ovarian cancer 3.800 3.0e-03
pancreatic cancer 1.300 3.8e-02
primary pancreatic ductal adenocarcinoma 4.444 5.5e-05
primitive neuroectodermal tumor -4.300 4.7e-03
urothelial carcinoma 3.300 5.0e-05

Gene RIF (61)

AA Sequence

MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVII      1 - 70
TTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE                                  71 - 111
//

Text Mined References (78)

PMID Year Title