Property Summary

NCBI Gene PubMed Count 70
PubMed Score 233.81
PubTator Score 86.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (31)

Disease log2 FC p
interstitial lung disease 2.900 3.9e-02
urothelial carcinoma 3.600 1.3e-06
astrocytic glioma -3.500 2.7e-03
posterior fossa group B ependymoma -5.200 4.7e-13
oligodendroglioma -2.800 9.1e-03
cutaneous lupus erythematosus -1.500 2.5e-03
glioblastoma -1.900 2.3e-02
sonic hedgehog group medulloblastoma -4.300 7.2e-04
atypical teratoid / rhabdoid tumor -3.800 1.5e-03
medulloblastoma, large-cell -5.900 1.6e-04
primitive neuroectodermal tumor -4.300 4.7e-03
Duchenne muscular dystrophy 1.955 8.7e-06
limb girdle muscular dystrophy 2A 1.573 7.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.360 1.7e-02
primary pancreatic ductal adenocarcinoma 4.444 5.5e-05
non-small cell lung cancer 3.823 2.1e-13
colon cancer -1.200 4.9e-02
lung cancer 5.900 1.2e-06
pancreatic cancer 4.400 3.4e-04
Breast cancer 2.800 2.5e-02
cystic fibrosis 1.700 2.6e-02
lung adenocarcinoma 2.644 4.9e-03
adult high grade glioma -2.100 4.3e-02
pilocytic astrocytoma -3.200 4.2e-04
nasopharyngeal carcinoma -1.700 3.4e-02
breast carcinoma -2.200 3.4e-19
gastric carcinoma 1.300 3.8e-02
ductal carcinoma in situ -1.200 5.4e-03
invasive ductal carcinoma -3.300 1.5e-03
ovarian cancer 3.800 3.0e-03
Down syndrome -1.200 2.1e-02

Synonym

Accession O95715 B3KQU8 Q6UW97 Q86U69 Q9BTR1 Q9NS21
Symbols KEC
KS1
BMAC
BRAK
NJAC
MIP2G
MIP-2g
SCYB14

Gene

PDB

2HDL  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (54)

PMID Text
26428435 Data indicate that CXC chemokine CXCL14, CXC chemokine receptor CXCR7 and the ratio between CXC chemokine receptor CXCR4-2 and CXCR4-1 could predict diseae free survival in Ewing sarcoma patients.
25822025 Prometastatic effects of IRX1 were mediated by upregulation of CXCL14/NF-kappaB signaling.
25760073 Elevated S100A6 enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25451233 essential CXCL12-operated functions of CXCR4 are insensitive to CXCL14
25411967 three of these five genes (CXCL14, ITGAX, and LPCAT2) harbored polymorphisms associated with aggressive disease development in a human GWAS cohort consisting of 1,172 prostate cancer patients.
25102097 Data indicate that site-specific CpG methylation in the CXC chemokine CXCL14 promoter is associated with altered expression.
24938992 CXCL14 overexpression influences proliferation and changes in cell cycle distributions of HT29 colorectal carcinoma cells.
24710408 Genetic or pharmacologic inhibition of NOS1 reduced the growth of CXCL14-expressing fibroblasts.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 14 (CXCL14) in primary human brain microvascular endothelial cells
24099668 CXCL14 inhibits colorectal cancer migration, invasion, and epithelial-to-mesenchymal transition (EMT) by suppressing NF-kappaB signaling.
24033560 CXCL14 plays a pivotal role as a potential tumor suppressor in hepatocellular carcinoma.
23982764 Downregulation of CXCL14 expression is associated with gastric adenocarcinoma.
23669361 CXCL14 represents, along with CXCR7, molecules that co-evolved with the CXCL12-CXCR4 axis to modulate important physiological processes in development, stem cell maintenance, and immune responses
23597004 Smoking-induced CXCL14 expression in the human airway epithelium links chronic obstructive pulmonary disease to lung cancer.
23294544 CXCL14 might be a potential novel prognostic factor to predict the disease recurrence and overall survival and could be a potential target of postoperative adjuvant therapy in CRC patients
23161284 CXCL14 binding to glycoproteins harboring heparan sulfate proteoglycans and sialic acids leads proliferation and migration of some cancer cells.
22910931 CXCL14 is a negative regulator of growth and metastasis in breast cancer.
22382027 These results indicated that upregulation of BRAK was accompanied by differentiation of epithelial cells induced by calcium/calmodulin signaling, and that SP1 binding to the BRAK promoter region played an important role in this signaling.
21556757 The rs2237062 polymorphism in the CXCL14 gene might influence Hepatits B Virus-related hepatocellular carcinoma progression in a Chinese population.
20815772 The results indicate that oxidative stress induced by H(2)O(2) or HO(*) stimulates angiogenesis and tumuor progression by altering the gene expression of CXCL14 via the EGFR/MEK/ERK pathway in human HNSCC cells.
20737948 CEACAM-1 and CXCL-14 are involved in the occurrence and development of infantile hemangioma.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20562917 CXCL14 methylation in sputum from asymptomatic early-stage lung cancer cases was associated with a 2.9-fold elevated risk for this disease compared with controls, substantiating its potential as a biomarker for early detection of lung cancer
20503287 Observational study of gene-disease association. (HuGE Navigator)
20478268 Taken together, the data indicate that the respective stress-dependent action of p38 isoforms is responsible for the up-regulation of the gene expression of the chemokine BRAK/CXCL14.
20460540 CXCL14 removal from conditioned media abolished its chemotactic properties. Findings offer direct evidence for epigenetic regulation of chemokine expression in tumor cells.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20212097 Increased severity of collagen-induced arthritis in CXCL14-transgenic mice is associated with enhanced T helper (Th) type 1 cytokine production, elevated autoantibody levels and increased inflammatory cell infiltration into the joints.
20067447 Data indicate that the expression of BRAK stimulated the formation of elongated focal adhesions of the HSC-3 cells in an autocrine or paracrine fashion, in which stimulation may be responsible for the reduced migration of the cells.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19903701 Data conclude that CXCL14 is likely to be regulated by progesterone in human endometrium and that it may exert a chemoattractive effect on uNK cells and in part be responsible for their clustering around the epithelial glands.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19833716 Results suggest that CXCL14 plays an important role in regulating trophoblast invasion through an autocrine/paracrine manner during early pregnancy.
19339694 -A-induced migration depends on the selective and polarized release of 2 chemokines, namely CXC chemokine ligands 12 and 14
19276362 CXCL14 expression is upregulated by ROS through the AP-1 signaling pathway and promotes cell motility through elevation of cytosolic Ca(2+) by binding to the inositol 1,4,5-trisphosphate receptor on the endoplasmic reticulum in breast cancer.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19218429 identify CXCL14 as a novel autocrine stimulator of fibroblast growth and migration, with multi-modal tumor-stimulatory activities
19172796 regulates energy metabolism and eating behaviior, induces insulin resistance, suppresses induction of neovascularization. (review)
19109182 Cell supernatant-derived CXCL14 fights bacteria at the earliest stage of infection, well before the establishment of inflammation, and thus fulfills a unique role in antimicrobial immunity.
18809336 Data suggest that despite the structural homology and similarity in tissue distribution of human and murine CXCL14, distinct differences point to diverse, species-specific needs for CXCL14 in epithelial immunity.
18765527 CXCL14-positive epithelial cells were found in all tissue types. The expression of CXCL14 was not associated with any tumor or patient characteristics analyzed
18762809 CXCL14 is a gene target of RhoBTB2 and supports downregulation of CXCL14 as a functional outcome of RhoBTB2 loss in cancer.
18676742 CST6, CXCL14, DHRS3, and SPP1 are regulated by BRAF signaling and may play a role in papillary thyroid carcinoma pathogenesis
18054154 CXCL14 might play a pivotal role in the pathobiology of pancreatic cancer, probably by regulating cancer invasion.
17703412 Observational study of gene-disease association. (HuGE Navigator)
16987528 This study elucidates a post-translational mechanism for the loss of CXCL14 in cancer and a novel mode of chemokine regulation.
16884687 results indicate that BRAK/CXCL14 is a chemokine, having suppressive activity toward tumor progression of oral carcinoma in vivo
16175604 Observational study of gene-disease association. (HuGE Navigator)
15843547 CXCL14 is a potent chemoattractant and activator of dendritic cells (DC) and may be involved in DC homing in vivo.
15651028 The finding that CXCL14 expression inhibits prostate tumor growth suggests this gene has tumor suppressive functions.
15548693 loss of BRAK expression from tumors may facilitate neovascularization and possibly contributes to immunologic escape
12949249 CXCL14 displays antimicrobial activity against E. coli and S. aureus.

AA Sequence

MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVII      1 - 70
TTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE                                  71 - 111
//

Text Mined References (71)

PMID Year Title
26428435 2015 CXCL14, CXCR7 expression and CXCR4 splice variant ratio associate with survival and metastases in Ewing sarcoma patients.
25822025 2015 IRX1 hypomethylation promotes osteosarcoma metastasis via induction of CXCL14/NF-?B signaling.
25760073 2015 Elevated S100A6 (Calcyclin) enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25451233 2014 CXCL14 is no direct modulator of CXCR4.
25416956 2014 A proteome-scale map of the human interactome network.
25411967 2014 A systems genetics approach identifies CXCL14, ITGAX, and LPCAT2 as novel aggressive prostate cancer susceptibility genes.
25102097 2014 Alterations to DNA methylation and expression of CXCL14 are associated with suboptimal birth outcomes.
24938992 2014 Expression and effect of CXCL14 in colorectal carcinoma.
24710408 2014 Cancer-associated fibroblasts expressing CXCL14 rely upon NOS1-derived nitric oxide signaling for their tumor-supporting properties.
24099668 2013 Epigenetic silencing of CXCL14 induced colorectal cancer migration and invasion.
24033560 2013 Antitumor efficacy of C-X-C motif chemokine ligand 14 in hepatocellular carcinoma in vitro and in vivo.
23982764 2013 Abnormal hypermethylation of promoter region downregulates chemokine CXC ligand 14 expression in gastric cancer.
23669361 2013 CXCL14 is a natural inhibitor of the CXCL12-CXCR4 signaling axis.
23597004 2013 Smoking-induced CXCL14 expression in the human airway epithelium links chronic obstructive pulmonary disease to lung cancer.
23294544 2013 Chemokine CXCL14 is associated with prognosis in patients with colorectal carcinoma after curative resection.
23161284 2013 CXCL14 enhances proliferation and migration of NCI-H460 human lung cancer cells overexpressing the glycoproteins containing heparan sulfate or sialic acid.
22910931 2012 Expression of CXCL14 and its anticancer role in breast cancer.
22382027 2012 Calcium-calmodulin signaling induced by epithelial cell differentiation upregulates BRAK/CXCL14 expression via the binding of SP1 to the BRAK promoter region.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21556757 2012 An intronic polymorphism rs2237062 in the CXCL14 gene influences HBV-related HCC progression in Chinese population.
20815772 2010 Reactive oxygen species (ROS) reduce the expression of BRAK/CXCL14 in human head and neck squamous cell carcinoma cells.
20737948 2010 [The expression of CEACAM-1 and CXCL-14 in infantile hemangioma].
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20562917 2010 Re-expression of CXCL14, a common target for epigenetic silencing in lung cancer, induces tumor necrosis.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20478268 2010 Human p38 delta MAP kinase mediates UV irradiation induced up-regulation of the gene expression of chemokine BRAK/CXCL14.
20460740 2010 Functional characterization of proximal promoter of gene for human BRAK/CXCL14, a tumor-suppressing chemokine.
20460540 2010 Epigenetic mechanisms of promigratory chemokine CXCL14 regulation in human prostate cancer cells.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20212097 2010 Overexpression of CXC chemokine ligand 14 exacerbates collagen-induced arthritis.
20067447 2010 Expression of tumour-suppressing chemokine BRAK/CXCL14 reduces cell migration rate of HSC-3 tongue carcinoma cells and stimulates attachment to collagen and formation of elongated focal adhesions in vitro.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19903701 2010 Progestin regulates chemokine (C-X-C motif) ligand 14 transcript level in human endometrium.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19833716 2009 The cytokine gene CXCL14 restricts human trophoblast cell invasion by suppressing gelatinase activity.
19339694 2009 Activin A induces dendritic cell migration through the polarized release of CXC chemokine ligands 12 and 14.
19276362 2009 Mitochondrial dysfunction and reactive oxygen species imbalance promote breast cancer cell motility through a CXCL14-mediated mechanism.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19218429 2009 CXCL14 is an autocrine growth factor for fibroblasts and acts as a multi-modal stimulator of prostate tumor growth.
19172796 2008 [Novel roles of CXCL14 in obesity and glucose metabolism].
19109182 2009 Potent and broad-spectrum antimicrobial activity of CXCL14 suggests an immediate role in skin infections.
18809336 2008 Constitutive expression of CXCL14 in healthy human and murine epithelial tissues.
18765527 2008 Epithelial and stromal cathepsin K and CXCL14 expression in breast tumor progression.
18762809 2008 The atypical Rho GTPase RhoBTB2 is required for expression of the chemokine CXCL14 in normal and cancerous epithelial cells.
18676742 2008 Gene expression profiling of papillary thyroid carcinoma identifies transcripts correlated with BRAF mutational status and lymph node metastasis.
18054154 2008 CXCL14 expression and potential function in pancreatic cancer.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
16987528 2006 Structural determinants involved in the regulation of CXCL14/BRAK expression by the 26 S proteasome.
16884687 2006 BRAK/CXCL14 expression suppresses tumor growth in vivo in human oral carcinoma cells.
16381901 2006 The LIFEdb database in 2006.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16175604 2005 Large-scale search of single nucleotide polymorphisms for hepatocellular carcinoma susceptibility genes in patients with hepatitis C.
15843547 2005 Loss of new chemokine CXCL14 in tumor tissue is associated with low infiltration by dendritic cells (DC), while restoration of human CXCL14 expression in tumor cells causes attraction of DC both in vitro and in vivo.
15651028 2005 Modulation of CXCL14 (BRAK) expression in prostate cancer.
15548693 2004 BRAK/CXCL14 is a potent inhibitor of angiogenesis and a chemotactic factor for immature dendritic cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11561000 2001 Monocyte selectivity and tissue localization suggests a role for breast and kidney-expressed chemokine (BRAK) in macrophage development.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10946286 2000 Molecular cloning and characterization of a novel CXC chemokine macrophage inflammatory protein-2 gamma chemoattractant for human neutrophils and dendritic cells.
10854217 2000 In vivo expression of the novel CXC chemokine BRAK in normal and cancerous human tissue.
10049774 1999 Cloning of BRAK, a novel divergent CXC chemokine preferentially expressed in normal versus malignant cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.