Property Summary

NCBI Gene PubMed Count 1,027
PubMed Score 2853.24
PubTator Score 1837.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (35)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.144 1.4e-02
osteosarcoma -5.407 8.0e-06
cystic fibrosis 1.567 9.3e-05
periodontitis 1.200 6.8e-31
atypical teratoid / rhabdoid tumor -1.400 2.2e-02
glioblastoma 1.200 8.6e-03
medulloblastoma, large-cell -1.900 1.7e-04
Duchenne muscular dystrophy 1.655 3.5e-08
limb girdle muscular dystrophy 2A 1.099 4.2e-04
Atopic dermatitis -2.000 7.9e-03
adrenocortical carcinoma -3.775 1.3e-06
pancreatic ductal adenocarcinoma liver m... -2.232 3.7e-02
non-small cell lung cancer -1.923 5.7e-13
intraductal papillary-mucinous adenoma (... -5.200 2.4e-07
intraductal papillary-mucinous carcinoma... -5.000 3.7e-06
intraductal papillary-mucinous neoplasm ... -5.500 6.2e-05
colon cancer -3.500 1.2e-03
lung cancer -2.400 4.5e-06
pancreatic cancer -2.400 5.5e-03
breast carcinoma -2.000 2.6e-29
fibroadenoma -1.600 8.3e-03
Breast cancer -2.400 3.1e-02
interstitial cystitis 1.900 3.6e-04
sonic hedgehog group medulloblastoma 1.800 1.1e-02
primary Sjogren syndrome 1.900 1.6e-03
aldosterone-producing adenoma -1.681 2.5e-02
subependymal giant cell astrocytoma 3.236 3.1e-02
lung adenocarcinoma -1.700 2.3e-05
invasive ductal carcinoma -2.400 8.8e-05
lung carcinoma -1.400 3.7e-10
Alzheimer's disease 1.300 3.5e-02
Pick disease 1.400 6.6e-03
mucosa-associated lymphoid tissue lympho... 2.738 1.8e-02
ductal carcinoma in situ -1.600 1.9e-03
ovarian cancer -2.600 5.1e-05

Protein-protein Interaction (6)

Gene RIF (1062)

PMID Text
27041792 Study shows that serum concentrations of CXCL12 were significantly higher, while those of its receptor CXCR4 were significantly lower in esophageal cancer (EC) patients suggesting that suggest that serum CXCR4 and CXCl12 may improve the diagnosis of EC patients.
26896000 Study suggests that CXCR4-SDF-1 axis is involved in mobilization and trafficking of epithelial circulating tumor cells in primary breast cancer.
26851944 Data suggest targeting the stromal cell-derived factor-1 (SDF-1)/chemokine receptor 4 (CXCR4) axis might provide a therapeutic strategy for endometrial cancer (EC) treatment.
26818832 Membranous expression of SDF-1 was a marker of poor prognosis and proved to be an independent prognostic parameter for the entire cohort and for patients with adenocarcinoma
26806619 Cell migration towards CXCL12 in leukemic cells compared to breast cancer cells.
26782945 overexpression of SDF-1 enhanced EMT by activating the NF-kappaB pathway of MCF-7 cells and further induced the formation of CSC-like phenotypes, ultimately promoting the proliferation and metastasis of MCF-7 cells
26782415 these results indicate that the chemokine receptor CXCR4 and its ligand CXCL12 play important roles in the occurrence and development of bladder cancer.
26782381 We conclude that the CXCL12 G801A polymorphism is a risk factor that increases susceptibility to gliomas in a subset of the general Han Chinese population.
26722521 In breast cancer patients, CXCL12 exhibited significant differences in expression between primary tumor and lymph node metastasis tumor
26722422 CXCL12 could trigger epithelial to mesenchymal transition of breast cancer cells.
26721717 that the roles of CXCR4, CXCR7, and CXCL12 are associated with trophoblastic cells apoptosis and may be linked to the occurrence and development of severe preeclampsia
26718114 findings demonstrate that Twist-1, which maintains BMSC at an immature state, endows them with an increased capacity for supporting hematopoiesis via direct activation of CXCL12 gene expression.
26602164 Blood fibrocytes are recruited during COPD exacerbations and related to mortality and low lung function. The CXCL12/CXCR4 axis is involved in such fibrocyte recruitment.
26560447 interstitial fluid flow promoted invasion of hepatocellular carcinoma derived cell lines via the C-X-C chemokine receptor type 4 (CXCR4)/C-X-C motif chemokine 12 (CXCL12) signaling axis.
26552750 Consistent with the loss of CXCR4 and gain in CD26, migratory responses to exogenous CXCL12 were eliminated in cells pretreated with cytotoxic agents, although cells retained basal motility
26538086 Its remarkable effect on inhibiting CXCR4/CXCL12-mediated adhesion and migration of AML cells.
26463123 This suggests that N-WASP's failure to compensate for WASP in rescuing chemotaxis could be due to the absence of this I30 region.
26441035 In atrial fibrillation patients, a higher SDF-1alpha level was found in patients with a more progressive state of arrhythmia and was associated with longer hospitalizations.
26435001 ERalpha/CXCL12 signaling positively regulated bisphenol AF-induced proliferation of cultured T47D breast cancer cells.
26414794 CXCL12/CXCR4 activation by cancer-associated fibroblasts mediated integrin beta1 clustering at the cell surface and promoted the invasive ability of gastric cancer cells
26413812 show that JAK2 mediates the activation of the small GTP-binding protein RhoA, in turn controlling LFA-1 affinity triggering by CXCL12
26408542 Production of SDF-1alpha in infarcted myocardium in the chronic phase of MI was associated with LV adverse remodeling and progressive dysfunction in AMI survivors.
26406413 mRNA expression of SDF-1 was significantly elevated in colorectal cancer.
26398122 We show that the CXCR4 antagonist, plerixafor, decreased the level of CXCR4 expression and inhibited SDF-1-induced migration of leukemic cells
26374452 CXCL12 was expressed in 43.3 % and CXCR4 in 66.1 % of the samples and both were correlated with HPV/p16(INK4A) positivity.
26349988 miR-101-CXCL12 pathway is partially responsible for cancer-associated fibroblast-mediated progression of lung cancer
26338423 These results suggest that targeting the production of CXCR4 and blocking the CXCL12-CXCR4 pathway might be effective strategies for treating NSCLCs harboring a specific type of EGFR mutation.
26330165 at elevated concentrations of CXCL12 that were insufficient to trigger chemotaxis of PDAC cells, AMPK blockade resulted in increased cell movement.
26324845 findings demonstrate the association of the variant, rs1746048, with increased cardiovascular disease mortality in UK patients with rheumatoid arthritis
26296527 extremely high levels of SDF-1 provide a crucial microenvironment for epidermal keratinocyte proliferation in both physiologic and pathologic skin conditions
26277915 CXCL12 was expressed mainly in vascular endothelial cells. The recurrence pattern was significantly related to this. However, CXCR4 was not an independent prognostic factor for progression-free survival or overall survival.
26235278 Data show that notch pathway is activated in ovarian cancer specimens and correlates with chemokine receptor CXCR4/chemokine CXCL12 (SDF1alpha) expression and high proliferation levels.
26231656 Results show that SDF-1alpha concentration modulates migration and adhesion of breast cancer cells, by controlling expression and activation of RhoGTPases.
26212341 Reduced pleural CXCL12 is associated with prolonged air link after lung resection. CXCL12 promotes alveolar epithelial cell migration by binding to its receptor CXCR4 and may have a role in lung healing.
26205534 that elevated serum CXCL12 level at admission was an independent diagnostic and prognostic marker in patients with acute ischemic stroke
26191295 TNF-alpha/rs1799724 and CXCL12/rs266085 polymorphisms are associated with cervical cancer
26188201 Further understanding of the regulatory mechanisms of CXCL12-mediated signaling in trophoblast functions and placental angiogenesis may help to design novel therapeutic approaches for pregnancy-associated diseases
26168882 SDF1 may contribute susceptibility to HIV-1 infection in the route of sexual intercourse.
26166636 The CXCL12/CXCR4 signal pathway modulates the recruitment of natural killer cells to the decidua.
26133117 no association was found between rs1801157 of (SDF)-1 gene and the susceptibility to CHD in either Caucasians or Asians
26130416 Increasing evidence from previous studies suggested that C-X-C motif chemokine 12 (CXCL12)and its receptor CXCR4 may provide novel diagnostic and prognostic strategies to reduce the burden of Esophageal cancer
26103953 Our data indicate that miR-448 functions as a tumor suppressor in ovarian cancer, which exerts its activity by suppressing the expression of CXCL12.
26100385 Study demonstrated that serum chemokine ligand-12 levels increased significantly following acute ischemic stroke, and these changes in serum CXCL12 were positively correlated with infarct volume and stroke severity in Chinese sample.
26100110 The CXCL12-CXCR7 autocrine loop affects tumor endothelial cell proangiogenic properties.
26096543 Although susceptibility to infections cannot be completely dependent on one or few genetic variants, it is important to remember that SDF-1 and CCR5 variants have been correlated globally with HIV-1 infection
26082290 These data suggest that SDF1 produced by dental pulp plays an important role in homeostasis, repair and regeneration via the recruitment of mesenchymal stem cells.
26072067 Result indicated that CXCL12 G801A polymorphism is a risk factor for cancer especially in Asian and Caucasian populations. [meta-analysis]
26058075 T-ALL cells are in direct, stable contact with CXCL12-producing bone marrow stroma. Cxcl12 deletion from vascular endothelial, but not perivascular, cells impeded tumor growth, suggesting a vascular niche for T-ALL.
26049754 Foxc1 is essential for progenitor cell development and maintenance of bone marrow niches for these cells upregulating CXCL12 and SCF expression and inhibiting of adipogenic processes in cell progenitors. (Review)
26044561 we implanted an Alzet osmotic pump with the stents to gradually release AMD3100, a specific inhibitor binding of SDF-1 and its receptor C-X-C chemokine receptor 4 (CXCR4), at the site of stents in mice that had developed pancreatic cancer.
26026718 SDF-1 promoted F5M2 cell migration by activating the AKT.
26008895 Endomyocardial expression of SDF-1 is enhanced in inflammatory cardiomyopathy, positively correlates with myocardial fibrosis and identifies high-risk patients with suspected myocarditis.
25997540 the CXCL12-CXCR4 axis regulated OS survival and metastasis through the JNK and Akt pathways, and blocking them with AMD3100 was found to be a potential OS treatment.
25995033 Synovial SDF-1 correlated with disease activity, and its receptor CXCR4 was related to joint destruction in rheumatoid arthritis patients treated with golimumab.
25982843 documented that CXCL12-3'A polymorphic variant can facilitate hematopoietic stem cell transplantation outcome from unrelated donors; presence of the CXCL12-3'A allele was found to be associated with a lower risk of early viral and toxic complications, as well as decreased risk of aGvHD if present in donor or recipient genotype
25976655 after estradiol (E2) treatment a marked increase in CXCL12 secretion and CXCR4 expression in secretory phase ESCs was observed together with decreases in autophagy grade, punctuate LC3B immunofluorescent staining and autophagy-associated protein levels
25966814 CXCR4/CXCL12 Signaling in Immature Hematopoiesis--Lessons From Pharmacological and Genetic Models.
25957946 The estradiol-CXCL12/CXCR4 signaling pathway may be useful in determining treatments for endometrial disorders, and may be antagonized to block stem cell migration to endometriosis.
25955316 CXCR4 and CXCR7 receptors play a role in organ selective homing and invasion. The balance in the expression levels of the two CXCL12 receptors reveals their participation into complex mechanisms controlling metastatic homing
25920609 CXCL12 derived from CAFs in tumor microenvironment stimulates CXCL12/CXCR4 signaling in AEG cells.
25897806 RGS1 suppresses CXCL12-mediated migration and AKT activation in cultured human plasmacytoma cells and plasmablasts.
25896762 Overexpression of miR-135b suppressed the invasion of extravillous trophoblast-derived HTR-8/SVneo cell by down regulating CXCL12.
25884570 CXCL12-mediated cell motility was CXCR7-dependent, with CXCR7 expression required for optimal expression of CXCR4 protein
25872129 Review of the role of chemokine receptors CXCR4/CXCR7 and their primary heterodimeric ligands CXCL12 and CXCL12/high mobility group box 1 in pancreatic cancer growth and development.
25860928 Recurrence of glioblastoma after chemoraditherapy could be associated with a switch of angiogenic pattern from VEGFR2-HIF1alpha to CXCL12-CXCR4 pathway.
25843954 HIF-1alpha and reactive oxygen species mediate radiation-induced invasiveness through the SDF-1alpha/CXCR4 pathway in non-small cell lung carcinoma cells.
25839939 Genetic association studies show that IL-6, TNF-alpha and SDF-1 SNPs not only controlled serum cytokine levels but also affected various risk factors of diabetic foot ulcer.
25839711 Deregulation of the CXCR4/CXCL12 axis was reported in melanoma tumorigenesis while also linked to BRAF mutation. Some chemokine-receptor patterns can direct the organ-specific metastasis.
25820929 investigated the role of human telomerase reverse transcriptase (h-TERT) on the protective effect of SDF-1alpha against senescence.
25815440 The well-known antioxidant Res effectively blocked these effects and reduced phosphorylation of nuclear factor (NF)-kappaB, an upstream activator of CXCR4. Furthermore, Res also suppressed VEGF secretion induced by SDF-1, a ligand of CXCR4
25810367 Developmental expression patterns of chemokines CXCL11, CXCL12 and their receptor CXCR7 in testes
25809793 SDF-1alpha is involved in homing of CXCR4+ GSLCs and leukocytes and that cathepsin K and osteopontin are involved in the migration of GSLCs out of the niches
25803672 Variant rs1801157 in the 3'UTR of SDF-1ss does not explain variability of healthy-donor G-CSF responsiveness
25797207 genetic polymorphism is not associated with Non-Small Cell Lung Cancer in Tunisian patients
25785610 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
25753525 leading to enhanced engraftment. Mild hyperthermia (39.5 degrees C) significantly increased the percent of CD34(+) cord blood that migrated toward SDF-1.
25748833 Reactive oxygen species increase the activity/levels of gelatinolytic matrix metalloproteinases, and stimulate cytokine secretion in human periodontal ligament fibroblast.
25744829 CXCL12alpha and CXCL12beta stimulate the migration of hepatic stellate cells.
25689618 This study aims to evaluate serum levels of ENA78/CXCL5 and SDF-1/CXCL12 along the gastric cancer carcinogenesis, and analyze their clinical significance, and diagnostic potentials through human serum samples.
25672413 The SDF13' A gene variant may be a risk factor for cervical carcinoma in patients with a positive history of tobacco smoking.
25660395 SDF-1 effects are mediated through CXCR4 and CXCR7
25620615 quantification of CXCL12 and ADAM23 methylation could be useful for the prediction of advanced stage of BC
25619477 Fraxiparine could significantly inhibit CXCL12-mediated chemotactic migration of A549 and 95D cells in a concentration-dependent manner.
25609203 Paracrine SDF-1alpha signaling mediates the effects of pancreatic stellate cells on gemcitabine chemoresistance through an IL-6 autocrine loop in pancreatic cancer cells.
25605248 High CXCL12 expression is associated with perineural invasion in pancreatic cancer.
25601176 Silent brain infarctions are associated with favorable outcomes in patients with first-ever acute lacunar infarction and lower levels of SDF-1alpha may contribute to favorable prognosis.
25560580 Neither women nor men with avoidant or obsessive-compulsive personality disorder showed any significant differences in MCP-1 or SFD-1 levels
25557636 The data indicate the importance of the CXCR4/CXCL12 axis in rectal tumor biology, and may suggest the CXCR4/CXCL12 receptor-ligand pair as a potential therapeutic target in metastatic rectal cancer.
25526031 Results identify macrophages as important players in MM tumorogenicity, and recognize the CXCR4/CXCL12 axis as a critical regulator of MM-stroma interactions and microenvironment formation.
25509878 The obtained results indicate that the changes in gene expression in bone marrow progenitor cells can be involved into space flight-induced osteopenia.
25504440 Data suggest that the intrinsic transforming growth factor beta 2-triggered stromal cell-derived factor-1-C-X-C chemokine receptor-4 signaling is crucial for drug resistance in bone marrow (BM)-slow-cycling disseminated tumor cells (DTCs).
25504108 data demonstrate that CXCR4 is a candidate gene involved in the development of metastastic lesions in specific organs, such as the lungs, bone and liver, which can secrete high concentrations of SDF-1, the sole ligand of CXCR4.
25482641 SDF-1/CXCR4 axis acts as a principle regulator in homing and engraftment of hematopoietic stem cells; however, CXCR4 signaling is dependent upon expression of CXCR4 and its ligand SDF-1, which is highly dynamic
25474514 We assessed the relative expressions of CXCL12, CXCR4 and CXCR7 in the stroma and the tumour of head and neck squamous cell carcinoma
25471741 CXCL12/CXCR4 signaling promotes cholangiocarcinoma progression and metastasis via canonical Wnt pathway.
25461737 Plasma CXCL12 level is a strong independent predictor of adverse cardiovascular outcomes in patients with CAD and improves risk reclassification
25461253 CXCL12 influences the development of extramedullary hematopoiesis in the spleens of myelofibrosis patients.
25460081 HPV16 E2 potentiated NF-kappaB activation induced by inflammatory mediators, IL-1beta and SDF-1alpha, in HEK293 cells
25450979 CD138 myeloma cell-directed cross-talk with BMSCs (bone marrow stromal cells) and reveal that CD138 myeloma cells regulate multiple myeloma-BMSC stiffness through SDF-1/CXCR4/AKT signaling.
25446160 stromal cell-derived factor-1alpha polymorphisms in 180 neonates revealed no differences between A/A, G/G and A/G allelic combinations
25433721 CXCL12 up-regulation may be differently linked to the development of primary central nervous system lymphomas and to the accumulation of tumor-infiltrated lymphocytes.
25421212 shows that SDF-1 up-regulates survivin via MEK/ERK and PI3K/AKT pathway, leading to cell cycle progression and epithelial-mesenchymal transition occurrence dependent on survivin
25407240 High expression rates of SDF1 is associated with pancreatic adenocarcinoma.
25400746 Data suggest that CXCL12 plays an important role in cell growth and invasion in human breast cancer.
25400739 SNCG, MAP2, SDF-1 and CXCR4 may play an important role in the carcinogenesis, progression, invasion and metastasis of gastric adenocarcinoma.
25393253 revealed enhanced mRNA levels for multidrug resistance 1 in a CXCL12 rich environment
25388055 The level of circulating SDF-1 increases in HHF patients.
25359780 CXCL12/CXCR4 signaling has a role in docetaxel-induced microtubule stabilization via p21-activated kinase 4-dependent activation of LIMK1
25359136 SDF1alpha-induced interaction of the adapter proteins Nck and HS1 facilitates actin polymerization and migration in T cells.
25344664 We review the function of SDF-1 and CXCR4 in the control of this process referring to our previous work in shoulder muscle and cloacal/perineal muscle development.
25326893 SDF-1 induces AKT and ERK phosphorylation. SDF-1 alone upregulates vimentin, snail, and N-cadherin. It downregulates E-cadherin. The SDF-1/CXCR4 axis triggers EMT, tumor cell invasion and proliferation via activation of PI3K/AKT and ERK pathways.
25313609 These findings suggest that CCR2, CX3CR1, RANTES and SDF1 gene variants seem to play an important role in the dynamics of HIV infection and could be used as drug or vaccine targets.
25312253 We show that E5 has high affinity to multiple AML cells with high CXCR4 level in a concentration dependent manner. E5 significantly inhibits CXCL12- or murine stromal cell (MS-5)-induced migration of leukemia cells
25310198 Targeting the CXCL12-CXCR4/JAK2/STAT3 signaling pathway may be a potential therapeutic strategy for the treatment of breast cancer.
25305322 Synaptic release of CCL5 storage vesicles triggers CXCR4 surface expression promoting CTL migration in response to CXCL12.
25297929 Six cases of primary mucosal malignant melanoma showed a high level of CXCL12 expression, while four cases had a low level of expression. High expression of CXCL12 correlated with a poor prognosis.
25283599 Rises in cAMP were significantly blunted by SDF-1alpha, which could also enhance collagen-mediated Ca2+ mobilisation, both of which were mediated by CXCR4.
25268356 The CXCL12 G801A polymorphism is associated with cancer risk. (Meta-analysis)
25241658 SDF-1a is upregulated after, and correlates with resistance to neoadjuvant chemoradiotherapy of locally advanced rectal cancer.
25237195 aberrant modulation of Rock1 expression and activity induced by ITD-FLT3 may enhance acute myeloid leukemia cell chemotaxis to the therapy-protective bone marrow niche, where Cxcl12 is abundantly expressed
25220301 The study has proved the prognostic values of peritumoral and intratumoral SDF-1 expression, identifying SDF-1 risk as an important prognostic factor for overall survival of gastric cancer patients.
25199050 Myelodysplastic syndrome bone marrow exhibited higher CXCL12(+) cell density than control or acute myelogenous leukemia marrow
25150783 SDF-1/CXCR4 axis activation-induced colorectal cancer invasion and EMT was effectively inhibited by the Wnt signaling pathway inhibitor Dickkopf-1.
25150002 There was an increase in SDF-1 and CCL-5 levels in women and men with different severities of depression, versus the healthy control group
25121739 suggest that CXCL12, acting through CXCR4, activates the Rac/ERK and JNK signaling pathways, which in turn initiates c-Jun phosphorylation, and recruits c-Jun and c-Fos to the CTGF promoter
25118993 Mesenchymal stem cells from children with severe aplastic anemia exhibit aberrant gene expression profiles and downregulation of CXCL12.
25085362 Results show that CXCL12/CXCR4 receptor and ligand are respectively expressed by different GBM cell populations and by the subventricular zone. Results suggest role of the CXCL12/CXCR4 signaling in an original model of brain cancer invasion.
25084358 CXCR7 acted as a functional receptor for CXCL12 in brain endothelial cells.
25042571 Gene microarray analyses identified CXCL12 as a major oestrogen-driven target gene in carcinoma-associated fibroblasts (CAFs), and CAFs recruit mast cells via CXCL12 in a CXCR4-dependent manner.
25041836 the differential expression of CXCR4 in intratumoral stroma and SDF1 in adjacent normal mammary cells may predict clinical outcome in breast cancer patients
25029540 Non-diabetic kidney transplant recipients carrying the SDF-1 AA/AG genotype and A allele have a greater risk of adverse long-term allograft outcome.
25025568 These results place Blk upstream of the p190RhoGAP-RhoA pathway in Galpha13-activated cells, overall representing an opposing signaling module during CXCL12-triggered invasion.
24982366 The CXCL12-CXCR4 axis may influence the expression of VEGFR3 in urothelial bladder carcinoma and promote tumor recurrence.
24970800 Data indicate that chemokine CXCL8 signaling regulates chemokines CCL2 and CXCL12 expression and secretion in PTEN phosphohydrolase-deficient prostate cancer cells.
24950177 The GG genotype of rs1801157 in SDF-1 is an independent risk factor for CHD in Chinese populations.
24950016 SDF-1 is implicated in several aspects of rheumatoid arthritis and osteoarthritis, from propagating inflammation to stimulating joint tissue destruction
24940843 CXCL12 plays a key role in endothelial cell sensing.
24934367 High levels of CXCL12 and CXCR4 expression were significantly associated with a poor recurrence-free survival and were the prognostic factors for ACP recurrence in pediatric patients.
24929539 Resistin-induced SDF-1 upregulation by activation of TLR4, p38 MARK and NF-kappaB may explain a new role of resistin in the link of obesity and gastric cancer.
24913264 This review presents evidence showing that CXCR4/CXCL12 signaling contributes to neural progenitor cells migration to areas of central nervous system damage. [review]
24909174 These studies identify CXCL12-gamma as a potent pro-metastatic molecule with important implications for cancer biology and effective therapeutic targeting of CXCL12 pathways.
24906407 our mechanistic in vitro assays and in vivo results suggest that a reduction in chemokine CXCL12 expression, with an enhancement of CXCR4 expression, provoked by COUP-TFI, could be associated with an increase in the invasive potential of breast cancer
24887021 These data indicates the existence of a SDF-1alpha induced DGKalpha - atypical PKC - beta1 integrin signaling pathway, which is essential for matrix invasion of carcinoma cells.
24877105 data suggest that CAFs and NPC tumor cells may enhance neoangiogenesis in a VEGF- and SDF-1-dependent manner by recruiting EPCs from the bone marrow into tumor stroma.
24870556 The potential functions of FOXP3 in breast epithelium can now be extended to include regulation of CXCR4 expression and response to the pro-metastatic chemokine CXCL12.
24853339 In addition to its capacity to control CXCL12 bioavailability, ACKR3 can either enhance or dampen CXCR4-mediated signaling and activity.
24839815 CXCL12 codon G801A polymorphism is not associated with either increased myeloid leukemia risk or extramedullary blast dissemination
24834915 The degree of valvular aortic stenosis correlates with SDF-1 platelet surface expression.
24825098 SDF-1G801A polymorphism is a risk factor of colorectal cancer susceptibility in our population in Tunisia
24819308 SDF-1/CXCR7 enhances ovarian cancer cell invasion by upregulation of MMP-9 expression.
24810923 Immunohistochemical analysis showed the co-expression of CXCR4 and CXCL12 correlated with lymph node metastasis and TNM stage
24806942 Disseminated tumor cells in the bone marrow may interfere with hematopoiesis by modulating CXCL12 in protected niches.
24799056 This review focuses on how CXCL12-CXCR4 helps the bone marrow in creating a tumor mircoenvironment that results in the cancer metastasis. It also discusses ongoing research regarding the clinical feasibility of CXCR4 inhibitors.
24762228 data showed that CXCR4 and GM1 (marker of lipid rafts) were expressed in both ovarian cancer tissue and SKOV3 cells, and SDF-1 promoted the invasion and migration of SKOV3 cells, which was mediated by complete lipid rafts.
24761914 The G801A polymorphism in the CXCL12 gene is associated with the risk of breast carcinoma.
24751515 SDF1-3'A polymorphism is associated with a decreased risk of myocardial infarction and early endothelial dysfunction, strongly confirming the important atherogenic role of SDF1 gene at clinical level.
24722947 CXCL12-CXCR4 signaling is involved in many functions within and outside the immune system and affects morphology of immature endothelial cells and neurons, as well as homing and maintenance of tissue stem cells, including HSCs, suggesting that CXCL12 and CXCR4 are the best candidates for the primordial chemokine and receptor.[Review]
24718687 Oversulfated chondroitin sulfate interacts with T cell chemokines that can impact adaptive immunity.
24708339 Different CXCL12 variants exist in blood plasma, with an abundance of N-terminally truncated CXCL12 variants.
24704323 In this article we examine the evidence for acute and chronic cardioprotective roles of SDF1alpha and discuss potential therapeutic manipulations of this mechanism with DPP-4 inhibitors to protect against lethal tissue injury in the clinical setting
24687413 CXCR4/CXCL12 chemokine axis polymorphisms may predispose to the development of inflammatory bowel disease.
24667918 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
24658853 hepatic stellate cells can promote hepatocellular carcinoma cell invasion through the SDF-1/CXCR4 axis
24637920 Local SDF-1/CXCR4 signaling functions to preserve microvascular integrity and prevent renal fibrosis.
24614402 Knock-down of CD44 resulted in an upregulation of mRNA expression of the chemokines CXCL9 and CXCL12, as well as their receptors CXCR3 and CXCR4.
24600982 findings of this study demonstrated that serum concentrations of CXCL1 and CXCL12 were elevated in SCD patients when compared with controls
24594697 These data demonstrate a functional tumor suppressive role for the normal expression of CXCL12 in pancreatic ducts, regulating both tumor growth andcellulardissemination to metastatic sites.
24586072 NCOA1 plays a necessary role in E2-induced CXCL12 expression and NCOA2 is required for P4 to inhibit the E2-induced CXCL12 production in normal and ectopic endometrium.
24584347 MicroRNA-23a mediates post-transcriptional regulation of CXCL12 in bone marrow stromal cells.
24574213 SDF-1 induces osteoclastogenesis directly and indirectly via up-regulating RANKL expression in rheumatoid arthritis synovial fibroblasts and CD4+ T cells, and that this is mediated by TNFalpha.
24561124 CXCL12 promotes glioblastoma multiforme cell invasion in part by increasing the expression of FOXM1, which is mediated in part by a PI3K/AKT-dependent mechanism in vitro.
24534089 eutopic endometrial stromal cells from deep infiltrating endometriosis patients are attracted into the peritoneal cavity through the interaction between CXCR4 expressed on their membrane and CXCL12 produced in the peritoneal cavity.
24516346 Our findings suggest upregulated expression of SDF-1 and its receptor CXCR4 in degenerated IVD
24498095 C-terminal engineering of CXCL12 and CCL5 chemokines: functional characterization by electrophysiological recordings.
24492963 CXCL12-dependent cell polarization and migration are reduced in Miro-1-silenced cells
24486245 ERbeta and CXCL12/CXCR4 expression in lung adenocarcinoma depends on sex and hormonal status, which may partly explain the sex and hormonal differences in lung cancer behavior.
24480462 identified the putative site for the binding of CXCL12 N-terminus and provided new structural elements to explain the recognition of gp120 and dimeric CXCR4 ligands
24465621 SDF1-A appears to play a critical role in modulating Lin-/Sca1+ cell migration to ischemic brain.
24450273 binding of CXCL12 to CXCR7 activates the ERK and Akt cell-survival pathways in JAR cells
24430363 polymorphism in CXCR2C1208T and CXCL12G801A showed high risk for breast cancer in north Indian population. However, CCR532 exhibited no association.
24416254 the correlation between SDF-1, CXCR4 and CXCR7 protein levels in endometrial cancer
24407584 Stromal derived factor-1 plays a major role in endometrial cancer invasion.
24381939 Here we review studies on enhancement of SDF-1-directed migration of MSCs with the premise that their improved recruitment could translate to therapeutic benefits.
24372262 We hypothesize that a normal level of SDF1 after chemotherapy and after haematopoietic stem cell transplantation could be associated with a more rapid recovery of haematopoiesis including platelet recovery.
24361877 Association analysis showed that frequencies of the rs1801157AA genotype and A allele of SDF-1 were significantly higher in coronary artery disease cases than in controls.
24354491 Decreased expressions of SDF-1alpha/CXCR4 and VEGF in the placental bed could be associated with the pathogenesis of pre-eclampsia.
24291546 SDF-1 isoforms are differentially expressed in bladder tissues and exfoliated urothelial cells.
24282276 Data show that the CXC chemokine receptor 4 (CXCR4) antagonist AMD 3100 disrupted the stromal cell-derived factor 1 (SDF-1alpha)/CXCR4 axis and decreases platelet-derived growth factor B (PDGF-B) protein expression in vivo in two xenograft Ewing tumor models.
24277075 the present study reveals for the first time an essential role of CXCR7, together with CXCR4, in the control of CD34+ survival, cell cycling, and colony formation induced by CXCL12.
24238971 The SDF-1 expression observed in noncancerous liver tissues of colorectal cancer with liver metastasis was significantly higher than that observed in normal liver tissues of benign liver disease.
24218400 levels of CXCL12, an important factor in angiogenesis, were significantly lower in menorrhagia patients compared with control women
24184476 study indicated that the angiogenesis of adipose tissue-derived mesenchymal stem cells (ADSCs) is, at least partly, mediated by SDF-1/CXCR4 and SDF-1/CXCR7 axis. However, only binding of SDF-1/CXCR7 was required for proliferation of ADSCs, and CXCR7 was required for migration of ADSCs induced by SDF-1.
24175834 High CXCL12 expression promotes proliferation and invasion of pancreatic cancer.
24174685 Transgenic CXCL12- and CXCR7-deficient mice display lack of CXCR4 internalization and increased CXCR4 levels, pointing to a role for CXCR7 in controlling CXCL12 availability in this signaling system.
24157575 CXCL12/CXCR4 interaction mediates survival and self-renewal in glioblastoma cancer stem cells.
24116850 endothelial CXCR7 regulates circulating CXCL12 levels and that CXCR7 inhibitors might be used to block CXCL12-mediated cell migration for therapeutic purposes.
24102302 Platelet-bound SDF-1 and CD34(+) progenitor cells are especially increased in patients with severe impairment of left ventricular systolic function in CHF.
24097873 Predictive marker analysis indicated that plasma levels of VEGF-D, Ang2, and SDF1 significantly predicted for benefit or lack of benefit from bevacizumab in this population.
24094005 Increased expression of CD164 is involved in ovarian cancer progression via the SDF-1alpha/CXCR4 axis.
24091662 CXCL12-induced CXCR4 signaling depends on the binding of high-molecular-weight hyaluronic acid to CD44.
24086760 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
24085800 High SDF1alpha expression is associated with liver metastasis in colorectal cancer.
24079738 alpha-MSH acts on melanocytes to produce melanin as well as stimulates the cells to migrate to the site where they work through CXCR4 up-regulation towards SDF-1alpha
24038789 SDF1 exerts a quiescent effect on resident c-kit(+) CSPCs by decreasing CK1alpha levels, increasing GSK3b activity, stabilizing b-catenin, and affecting regulation of the cell cycle through Bmi-1 and cyclin D1.
24033610 SDF-1/CXCR4 signalling may be a new therapeutic target and strategy to promote repair and regeneration in endodontics
24032722 CXCL12 rs1801157AA genotype is significantly correlated with the development of renal cell carcinoma.
24025971 CXCL12 and CXCR4 have a single ligand-single receptor relationship in mediating non-small cell lung cancer migration and metastasis, and in context of NSCLC that expresses CXCR4, the CXCR4-CXCL12 axis is not involved in angiogenesis of the primary tumor
24024928 CXCL12 has roles in platelet activation and in myocardial function [review]
24024210 Our findings suggest that SDF-1alpha3'A (CXCL12) polymorphism plays a role in pathogenesis of asthma.
24022841 It induces lung cancer cell migration by polarized mtDNA redistribution.
24021782 Our findings indicate that CXCL12 may be an effective supplementary diagnostic marker for PTC in preoperative fine-needle aspiration cytology using the cell block method
24015267 chronic cadmium exposure stimulates the expression of SDF-1 by altering the molecular interactions between ERalpha, c-jun and c-fos.
24014104 SDF-1 restores angiogenesis synergistically with VEGF upon LDL exposure despite CXCR4 internalization and degradation.
24009233 LCP1 is functionally relevant to CXCL12 induced B-cell migration.
23985752 The expression of MIF mRNA was compared with VEGF mRNA expression and with mRNA expression of other chemokines related to neo-angiogenesis, such as CXCL12, CXCL11, CXCL8 and CXCR4, in human endometrial cancer tissue and normal endometrium.
23935395 The results showed that CXCL12 and CXCR4 expressions were down-regulated at the stage of BMP9-induced osteogenic differentiation, in a dose- and time-dependent.
23932459 genetic polymorphism is associated with lung function in Hutterites, who are a founder population of European descent in North America
23924922 SDF-1alpha acts through CXCR4 to induce ovarian cancer cell migration, which could be facilitated by CD40 activation.
23901140 analysis of a costimulatory mechanism by which CXCL12 and antigen converge at SLP-76 microcluster formation to enhance T cell responses
23895705 Expression levels of CXCR4 and CXCL12 are correlated with the invasiveness of pituitary adenomas.
23880174 SDF1-3'A variants may, in association with other polymorphisms, may account for the overall protection from HIV-1 infection in participants recruited from west region of Cameroon.
23869217 MDA-MB-231 cells migrated up a SDF-1alpha gradient, and the measured chemosensitivity (defined as the average cell velocity along the direction of the gradient) followed the ligand - receptor (SDF-1alpha - CXCR4) binding kinetics.
23812037 Data demonstrates a novel role of CXCL12 in stellate cell contraction.
23802178 NMR titrations with short sulfopeptides showed that the tyrosine motifs of CXCR4 varied widely in their contributions to CXCL12 binding affinity and site specificity.
23734232 Data indicate that CXCL12-induced phosphorylation at CXCR4 S346/347 was mediated by GRK2/3.
23712777 SDF-1alpha/CXCR4 upregulates MMP-2 expression and induces pancreatic cancer cell invasion in PANC-1 and SW-1990 cell lines by activating p38 MAPK.
23711392 The CXCL12-3'A variant was more frequently detected in patients with less advanced Multiple myeloma; these results imply that the CXCL12-3'A allele plays a favourable role in patients with multiple myeloma.
23710557 The development of pulmonary fibrosis in rheumatoid arthritis may be considered as the key event for the migration of stem cells to the injured lung through the SDF-1/CXCR4 axis.
23702796 The basic Lysine1 at the CXCL12 N-terminus, an essential residue in receptor activation, forms a strong polar interaction with the Glutamate32 in the CXCR4 extracellular region.
23701640 HGF and SDF-1 are required for effective mobilization and homing of CD133+ hematopoietic stem cells to the liver after hepatic resection.
23669361 CXCL14 represents, along with CXCR7, molecules that co-evolved with the CXCL12-CXCR4 axis to modulate important physiological processes in development, stem cell maintenance, and immune responses
23666823 CXCL12 SNPs are associated with ischemic stroke in Chinese population.
23653000 CXCL12 and TP53 genetic polymorphisms as markers of susceptibility in a Brazilian children population with acute lymphoblastic leukemia.
23645563 CXCL12 and CX3CL1 and their respective receptors are expressed in benign and malignant human nerve sheath tumors
23623275 Our results suggest that IBAfect-mediated delivery of CXCR4 into MSCs is a highly efficient technique that may be useful for enhancing the recruitment of systemically infused MSCs for tissue repair
23619587 CXCL12 is up-regulated in human spleens with extramedullary haematopoiesis.
23615182 these results indicated that polymorphism in CXCL12G801A and CXCR2(+1208)C/T showed high risk for end-stage renal disease in North Indian population.
23599431 CXCR7 is induced during monocyte-to-macrophage differentiation, which is required for SDF-1 and I-TAC signaling to JNK and p38 pathways, leading to enhanced macrophage phagocytosis
23591873 findings indicate that a chemokine-controlled pathway, consisting of Galphai2, ELMO1/Dock180, Rac1 and Rac2, regulates the actin cytoskeleton during breast cancer metastasis
23586735 Studies indicate that SDF-1a is rapidly inactivated by DPP-4-mediated cleavage, inhibition of this enzyme presents an alternative strategy of augmenting local SDF-1a bioactivity.
23563306 The SDF-1-CXCR4 axis is involved in the pathophysiology of the progression, recurrence and metastasis of malignant disease.
23544621 shear stress up-regulated the secretion of stromal-derived factor-1, which stimulated its receptor CXCR4 expression in human mesenchymal stem cells until the cells covered the wounded area.
23531450 CXCL12 protein single nucleotide polymorphism rs1746048 is a risk factor of the coronary heart disease in Han Chinese.
23526079 High CXCL12 and CXCR4 promotes invasion of bladder cancer cells through activation of Stat3 transcriptional activity.
23502337 decreased serum levels in patients with alopecia areata
23499762 Gradients of SDF-1alpha may be the main directive forces in multiple myeloma cell migration. SDF-1alpha cooperated with HDF in gradient-directed migration.
23495012 findings indicate that CXCL12 expression in the human testis may selectively influence seminoma migration and metastasis, correlating with its importance in gonocyte and spermatogonial stem cell biology
23473997 These results indicate that endogenous SDF-1 expression by AML cells plays a role in the autonomous growth of the cells.
23434321 Study provides evidence that the CXCR4/CXCL12 axis is essential for Malignant peripheral nerve sheath tumors (MPNST) tumor progression. Specifically, the autocrine activation of CXCR4 by CXCL12 triggers intracellular PI3-kinase and beta-catenin signals to promote G1 to S phase transition in MPNST cells.
23395387 Ethnically divergent populations show clear differences in both CXCR4 density and CXCL12 plasma levels which may influence the course of cancer and HIV-1 infection.
23344887 The CXCL12/CXCR4/CXCR7 system appears to be directly involved in microvessel growth, its members being differentially expressed in angiogenically activated microvessels and vascular sprouts.
23335032 based upon the results of the investigation, it is proposed that CXCL12 and its SDF-1 3'A polymorphism play a fundamental part in the pathogenesis of malignant glial tumors
23325742 Two hundred and twenty-one samples from HIV-infected subjects in Thailand were genotyped for the CCR5, CCR2, and SDF1 mutation. Results demonstrated that there was a significant association between CD4+ T-cell numbers and CCR2 and SDF1 polymorphisms.
23279723 This review will focus on the signaling and effects of the widespread chemokine CXCL12 and its long known G protein-coupled receptor CXCR4 and the recently discovered non-G protein-coupled receptor CXCR7. [review]
23259294 SDF-1 and CXCR4 protein are highly expressed in laryngocarcinoma and in metastatic lymph node tissue. Expression is correlated with lymph node metastasis, clinical stage and pathological grading.
23258739 The SDF1-3'A polymorphism may not be a candidate genetic variant to select individuals at higher risk of developing gastric cancer.
23249958 Significant associations of four SNPs and haplotypes with antibody response to cholera vaccine in three genes, MARCO, TNFAIP3 and CXCL12.
23246486 we provide evidence for a paracrine prostate stromal-epithelial interaction induced by upregulation of expression of SDF-1 by PGE2
23242967 SDF-1 gene polymorphism at position 801 (G>A) was not associated with colorectal and gastric cancers in Southern Iranian patients.
23224761 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
23207101 The HMGB1-CXCL12 heterocomplex constitutes a specific target that may hold promise for the treatment of several pathologies.
23193972 Data suggest that CXCL12 (and VEGFalpha-- vascular endothelial growth factor A) in follicular fluid reflects ovarian follicle luteinization; luteinizing granulosa cells appear to express and secret CXCL12 (and VEGFalpha) during luteinization.
23192056 determine whether there exists a relationship between SDF-1 alpha and endogenous sex hormones in aging men with stable coronary artery disease
23149815 We suggest SDF-1alpha as a biomarker of hyperlipidemia that may be helpful to uncover the pathogenesis of hyperlipidemia.
23148226 Heparin oligosaccharides inhibit chemokine (CXC motif) ligand 12 (CXCL12) cardioprotection by binding orthogonal to the dimerization interface, promoting oligomerization, and competing with the chemokine (CXC motif) receptor 4 (CXCR4) N terminus
23143873 Stromal cell-derived factor 1 induced time-dependent phosphorylation of extracellular signal-regulated kinases (ERK) 1/2, Akt-1, and diminished cyclic adenosine monophosphate.
23133664 Dasatinib inhibits CXCR4 signaling in chronic lymphocytic leukaemia cells and impairs migration towards CXCL12
23129313 SDF-1-3'A confers increased susceptibility to breast cancer and that the E-selectin S128R CC genotype may be related to poorer prognosis.
23098564 Our findings support the hypothesis that ICAM-1 up-regulation stimulated by SDF-1 may play an active role in CRC cell adhesion.
23078136 The findings of this study suggest that SDF-1 gene variations may be associated with the occurrence and prognosis of childhood ITP.
23071112 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
23070788 The expression of SDF-1 and CXCR7 were positively correlated with lymph node metastasis in papillary thyroid carcinoma.
23053994 SDF1-3'A and CXCR4 gene polymorphisms may not be risk factors for the susceptibility to prostate cancer.
23042661 The aim of this study was to test the hypothesis that elevated circulating baseline CXCL12 levels are associated with subsequent stroke.
23039915 High expression of SDF-1 is associated with renal cell carcinoma.
23023114 SDF-1alpha or MIF affects the metastasis-related behaviors of CXCR4-expressing colon cancer cells.
22995914 CXCL12/CXCR4 protein signaling axis induces sonic hedgehog expression in pancreatic cancer cells via extracellular regulated kinase- and Akt kinase-mediated activation of nuclear factor kappaB
22987307 CXCL12 protects human neural stem cells from apoptotic challenges through CXCR7- and CXCR4-mediated endocytotic signaling.
22978759 These results suggest that melanocytes may have a unique mechanism of migration via SDF1/CXCR7 signaling that is different from that of other cell types.
22975476 CXCL12 was elevated in acute lymphoblastic leukemia and decreased after bone marrow transplantation.
22962615 The rs1801157 SNP of SDF-1 does not influence perinatal HIV-1 infection, but impacts pediatric disease progression.
22954782 G801A polymorphism of human stromal cell-derived factor 1 gene raises no susceptibility to neoplastic lesions of uterine cervix.
22954308 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
22952422 SDF-1alpha-CXCR4 signaling represents a microenvironmental factor that can maintain mTOR pathway fidelity to promote resistance to mTOR-targeted therapy in pancreatic cancer by a variety of mechanisms.
22939870 Genetic polymorphisms in CXCL12 gene is associated with neoplasms.
22932666 the role of the CXCL12-CXCR4 axis as a novel chemoattractant for LECs in promoting lymphangiogenesis, and support the potential application of combined targeting of both chemokines and lymphangiogenic factors in inhibiting lymphatic metastasis.
22916293 Data suggest that CXCR7 elicits anti-tumorigenic functions, and may act as a regulator of CXCR4/CXCL12-mediated signaling in neuroblastoma.
22905867 Letter: platelets contain SDF-1a mRNA transcripts and thrombin stimulation induces mRNA maturation, leading to de novo synthesis of SDF-1a after activation.
22885527 a complicated cross-talk via the CXCL12/CXCR4 signal at the maternal/fetal interface in early human pregnancy.
22848341 CsA may promote EGFR activation via CXCL12/CXCR4 axis, and EGFR downstream ERK signaling pathway may be involved in the CsA-induced proliferation of human trophoblast cells.
22846168 current approach under investigation involves treatment of donor cells with inhibitors that target the protease CD26, a negative regulator of the chemokine CXCL12/stromal cell-derived factor-1
22844345 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
22842611 CXCL12 production by lymphoid tissue microenvironment in chronic lymphocytic leukemia patients might play a key dual role on T cell physiology, functioning not only as a chemoattractant but also as a costimulatory factor for activated T cells
22784557 CXCL12-CXCR4 axis maintains NSCs and serves as an emergent salvage signal for initiating endogenous stem cell-based tissue repair.
22779681 The ability of SDF-1A to activate CXCR4 signaling and internalization is dependent on the main chain amide bonds in the N-terminus of SDF-1A.
22767589 Our results suggest that the SDF-1/CXCR4 axis is important in angiogenesis and tumor cell intravasation.
22762525 The CXCL12 G801A polymorphism was risk factro of overall cancer in the homozygote comparison (AA vs. GG), the recessive model (AA vs. GG+GA), and the dominant model (GA+AA vs. GG).
22753620 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
22751460 CXCL12 levels in synovial fluid were closely related to the radiographic severity of osteoarthritis.
22738089 increased levels in pre-term infants
22736769 Regulatory pathways targeting CXCR7 C-terminal serine/threonine sites may control the CXCL12 scavenger activity of CXCR7.
22727731 The results suggest a substantial role of SDF-1 in the pathological relationship between cholangiocarcinoma cells and key stromal cells such as hepatic stellate cells.
22710983 preservation of direct CD271+ MSC/CD34+ HSPC contact across benign and neoplastic marrow suggests a physiologically important role for the CD271+ MSC/CD34+ HSPC relationship and abnormal exposure of CD34+ HSPCs to increased MSC CXCL12 expression in MDS
22704519 our results suggest that high endothelial venules development and engagement of SDF-1 contribute to myasthenia gravis (MG) pathology by recruitment of peripheral B cells and APCs to the MG thymus.
22699677 CXCR4 mRNA (p < 0.001) and CXCL12 mRNA (p = 0.02) relative expressions were significantly correlated with relative IFNgamma mRNA expression in breast cancer.
22690919 IL-17 and IL-18 upregulate the expression of stromal cell-derived factor via a phosphatidylinositol 3-kinase-dependent pathway.
22688512 sphingomyelin in lipid rafts decreases responsiveness to signaling by the CXCL12/CXCR4 pathway
22683307 REVIEW: CXCR4/CXCL12 axis' role in cancer
22675496 The chemokine CXCL12, its truncated form SDF-1(5-67), and the receptors CXCR4 and CXCR3 are expressed in human glaucomatous trabecular tissue and a human trabecular cell line.
22670173 Cyclosporin A promotes trophoblasts invasiveness by stimulating the secretion of CXCL12, and also limits the invasiveness of trophoblasts by indirectly up-regulating the expression CD82.
22664794 SDF-1alpha, released from activated hepatic stellate cells and AngII, play important roles in cancer progression, tumor fibrogenesis, and migration in autocrine and paracrine fashion
22613469 Upon stimulation with SDF-1, CXCR4 promotes modifications on the surface pattern of adhesion molecules, which have an influence on adhesion and migration.
22581230 Our findings suggest that IRX proteins integrate combinatorial transcriptional inputs to regulate key signaling molecules involved in the ontogeny of multiple organs during embryogenesis and homeostasis.
22568557 CXCL12-mediated endocytosis of CXCR4 was differentially regulated during aging, which could be attributed to alterations in the ubiquitination of CXCR4.
22554649 Studied the genetic variations in open reading frames and regulatory regions of CCR5, CXCR4 and SDF-1. Results show the great genetic heterogeneity within CCR5, CXCR4 and SDF-1 in Chinese Han, Mongol and Uyghur ethnic populations.
22553346 results indicate that gallbladder carcinoma (GBC) cells express both CXCL12 and its receptor CXCR4, and CXCL12 may have a role in GBC progression through an autocrine mechanism; CXCL12 is a novel independent poor prognostic factor in patients with GBCs
22549810 The ER-CXCL12-CXCR4 signaling axis may represent a promising target for development of therapeutics for ER+ ovarian cancers.
22549778 E-cadherin is critical for collective sheet migration and is regulated by the chemokine CXCL12 protein during restitution
22535492 SDF1alpha can induce dopaminergic neuronal differentiation in both NTera2 cells and human embryonic stem cell lines.
22529914 we recognized that [N33A]CXCL12 activates preferentially G-protein-dependent pathways and is an inhibitor of HER1.
22526457 low CCL27/CCR10 and CXCL12/CXCR4 intratumoral mRNA ratios are associated with melanoma progression
22513751 These findings suggest that VEGF and SDF-1alpha may mediate EPC proliferation in human ischemic stroke.
22496601 Results indicated that CXCL12/CXCR4 axis may play roles from early steps of oral malignant transformation and contribute to the progress of oral carcinogenesis.
22495096 CsA can promote the crosstalk between cytotrophoblast and DSC through up-regulating CXCL12/CXCR4 interaction via MAPK signaling, resulting in the increased numbers of and invasion by human cytotrophoblast cells
22492017 Data suggest that the controlled release of SDF-1 would be of great therapeutic value in the process of human mesenchymal stem cells (hMSCs) homing to injured tissues.
22490648 CXCL12, CCL2 and RANTES are co-expressed in human villus and decidua tissues. The lower CXCL12 mRNA expression and the higher expressions of CCL2 and RANTES mRNA play important roles in the pathogenesis of early abortion.
22473778 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
22469823 SDF-1alpha may play an important role in stem and progenitor cell recruitment and homing to injured sites in the periodontal ligament.
22450749 SDF-1/CXCR4 modulates the non-canonical Hh pathway by increasing the transcription of SMO in a ligand-independent manner.
22430135 These findings suggest a possible role for the CXCL12/CXCR4 axis in the metastatic evolution of non-small-cell lung cancer
22427929 CXCL12 mediates trophic interactions between endothelial and tumor cells in glioblastoma.
22415233 Patients whose tumours expressed high levels of CXCL12 had significantly poorer survival (P=0.026) than patients whose tumours failed to produce this chemokine.
22386691 There is lack of association between the CXCL12 rs501120 polymorphism and cardiovascular disease in Spanish patients with rheumatoid arthritis.
22370717 HMGB1-induced recruitment of inflammatory cells depends on CXCL12. HMGB1 and CXCL12 form a heterocomplex that acts exclusively through CXCR4 and not through other HMGB1 receptors.
22362916 Activation of the SDF-1/CXCR4 axis can contribute to early stages of gastric carcinogenesis primarily through recruitment of stromal cells and modulation of the progenitor niche.
22336440 Data indiacte that chemokine CXCL13 emerges as a new biological marker in early rheumatoid arthritis (RA), accurate in assessing the severity of synovitis.
22333149 The expression of SDF-1/CXCR4 is significantly abnormal in myelodysplastic syndrome patients, and is correlated with apoptosis and angiogenesis.
22311941 Polymorphism in CXCL12-3'G801A might be a genetic risk factor for developing systemic lupus erythematosus in a Han Chinese population.
22301555 CXCL12-induced monocyte-endothelial interactions promote lymphocyte transmigration across an in vitro blood-brain barrier.
22270883 we discuss the manner in which CXCR4 signaling can regulate the development of different structures in the central and peripheral nervous systems--{REVIEW}
22253872 Stimulation with CXCL12 induced increased chemotactic cell motility and blocking CXCR4 decreased extravasation of highly metastatic MDA-MB-231 cells.
22245379 these studies identify CXCL12 as a novel, non-steroidal growth factor that promotes the growth of prostate epithelial cells through AR-dependent mechanisms in the absence of steroid hormones.
22232208 data implicate an important role for the CXCR4/CXCR7/SDF-1 pathway in the pathogenesis of hemolytic uremic syndrome
22228277 SDF-1 concentration levels are increased in aqueous from patients with uveal melanoma, suggesting that this chemokine may be actively involved in the development of intraocular tumor vasculogenesis.
22220905 Methotrexate chemotherapy transiently alters bone marrow cellularity and composition and the reduced cellularity may be associated with deregulated CXCL12/CXCR4 chemotactic signalling.
22220212 The DNA methylation status of both CXCR4 and CXCL12 genes could be used as a biomarker for prognosis in breast cancer.
22200847 SDF-1alpha production in periodontal ligament cells was suppressed by treatment with FGF-2, but it recovered with treatment by FGF-2 plus SU5402 (an inhibitor of FGF receptor 1).
22173290 Suggest a distinct role of CXCR4/CXCR7/CXCL12 signaling in prognosis of osteosarcoma.
22169299 The SDF-1 expression level is related to cell apoptosis and angiogenesis in myelodysplastic syndrome.
22169298 The SDF-1/CXCR4 axis enhances the ability of cell adhesion and migration through PI3K signaling pathway in patients with myelodysplastic syndrome.
22166550 Results suggest that G/A polymorphism at position -801 promoter region of CXCL12 gene relates neither to the risk of the development of inflammatory bowel disease nor to the clinical subtypes of IBD in the Polish population.
22142194 Monomeric CXCL12 preferentially activated CXCR4 signalling through Galphai and Akt, whereas dimeric CXCL12 more effectively promoted recruitment of beta-arrestin 2 to CXCR4 and chemotaxis of CXCR4-expressing breast cancer cells.
22128293 Data suggest that conditions that mimic hypoxia act to decrease SDF-1 expression in hypoxia-inducible factor-1alpha-independent manner in endometrial stromal cells; such events may influence angiogenesis in endometrium.
22127289 The chaotic particle swarm optimization method can effectively identify SNP-SNP interactions in complex biological relationships underlying the progression of breast cancer.
22125123 Serum levels of SDF-1alpha (CXCL12) and its polymorphism play an important role in pathogenesis of multiple sclerosis.
22114110 Trophoblast-derived/secreted CXCL12 promotes expression of CXCR4 in plasma membrane of first-trimester decidual stromal cells; CXCL12 promotes invasion of decidual stromal cells via interaction with CXCR4.
22101518 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
22095608 there is no significant association of RANTES-28 and SDF-1 gene polymorphisms and occurrence of SLE in Malaysia.
22092872 IL-4 and IL-13 prime the migrational response of HPC to SDF-1alpha by enhancing the incorporation of CXCR4 into lipid rafts.
22088972 CXCR7 was elevated in the endothelium of explanted human hypertensive lungs and circulating CXCL12 levels were significantly elevated in disease. Alveolar hypoxia similar to that in lung disease increased CXCR7 expression in pulmonary endothelium.
22077991 CXCL12 gene polymorphisms may be associated with susceptibility to pulmonary tuberculosis among females.
22075627 CXCR4 expression in metastatic liver tumors together with the upregulation of CXCL12 in hepatocytes may help to predict the clinical outcomes of patients with CLM after hepatectom
22074556 upregulation of autocrine CXCL12 is a major mechanism underlying SLUG-mediated migration and invasion of prostate cancer cells
22071114 Data suggest that CXCL12 expression is significantly greater in syncytiotrophoblasts of pre-eclamptic placentae compared with normal placentae.
22066471 Cysteine cathepsins B, K, and L constitutively secreted by osteoblasts are part of the fine-tuned regulation of CXCL12 in the bone marrow.
22044645 Differential expression of platelet-bound and plasma SDF-1 was observed in patients with atrial fibrillation compared with SR
22025564 Findings indicate a central role for PGE(2) in myeloid-derived suppressor cells accumulation triggered by the CXCL12-CXCR4 pathway, providing a powerful rationale to target PGE(2) signaling in ovarian cancer therapy.
22025313 the results of this study suggest that CXCL12 expression is associated with longer overall survival and recurrence-free survival among estrogen receptor negative EC patients.
22015231 Plasma SDF-1 is significantly decreased in patients with STEMI, a fact which may reflect the importance of SDF-1 regulation in patients with acute myocardial infarction.
22008312 CXCL10, CXCL11, CXCL12 and CXCL13 chemokines are biomarkers in serum and cerebrospinal fluid in patients with tick borne encephalitis
21994039 Bone marrow of neuroblastoma patients shows downregulation of CXCL12 expression and presence of IFN signature
21968974 study concluded SDF-1beta 3'Alpha polymorphism does not play a role in the pathogenesis of type 2 diabetes but that elevated serum levels of SDF-1 may be important for the etiology of type 2 diabetes but are unrelated to the SDF-1beta 3'Alpha polymorphism
21964561 The excursion vector and the direction of the migration of endothelial progenitor cells induced by SDF-1alpha follow polarity.
21960286 Aberrant methylation of CXCL12 frequently occurs in the down-regulation of CXCL12 in gastric cancers and that it may play a role in the metastasis of gastric cancer.
21953583 CXCL12gamma shows a specific and similar distribution in rheumatoid arthritis synovium and lymphoid tissue, consistent with its higher heparan sulfate binding affinity. CXCL12 can play a distinct, heparan sulfate-dependent regulatory role in T cell activation
21951424 single biomarker evaluation of platelet SDF-1 surface expression is not helpful to predict ischaemic stroke.
21948620 Results provide strong evidence supporting that limbal SC function depends on close physical association with their native NCs via SDF-1/CXCR4 signaling.
21921288 CXCL12 stimulates the inside-out activation of laminin-specific integrins to promote cell migratory functions.
21910857 Both MCP-1 and SDF-1a are constitutively produced and released by the heart.
21909361 Recombinant human osteopontin up-regulates MMP-2 through the SDF-1alpha/CXCR4 axis.
21906874 Neuroblastoma expressed both of the SDF-1 receptors CXCR4 and CXCR7. shRNA knockdown showed that these receptors were responsible for the migration of neuroblastoma towards mesenchymal stromal cells.
21906588 In this first demonstration of SDF-1-CXCR4-induced microRNAs in breast cancer, it suggests that this signaling axis may promote tumorigenesis via microRNA regulation.
21878648 Chemokine CXCL12 uses CXCR4 and a signaling core formed by bifunctional Akt, ERK1/2, and mTORC1 proteins to control chemotaxis and survival simultaneously in mature dendritic cells.
21878545 SEMA-3A is involved in the regulation of CXCL12-driven human thymocyte migration, where it acts as a physiological antagonist.
21868522 While the splice variant SDF1alpha had no impact on tumor grading, T-cell invasion or overall survival, expression of SDF1beta showed a significant correlation with tumor grading and also suggested a correlation with metastasis, as well as CD8+ T-cell invasion
21856938 SDF-1 treatment of T cells induced the formation of a novel molecular signaling complex containing RasGRP1, Galphai2, and ZAP-70.
21856785 MicroRNA-126 modulates endothelial SDF-1 expression and mobilization of Sca-1(+)/Lin(-) progenitor cells in ischaemia.
21853930 Increased levels of SDF-1alpha in the peritoneal fluid of epithelial ovarian cancer patients may play an important role in its pathogenesis.
21853036 The reduced T cell responsiveness to CXCL12 induced by 5-HT may occur to facilitate T cell extravasation and migration into inflamed tissues.
21840752 In this series of 71 head and neck squamous cell carcinoma patients, the SDF-1 expression level correlated significantly with metastatic evolution and overall survival.
21818756 the SDF-1/CXCR4 axis might facilitate the migration of circulating B cells into tuberculous pleural space
21802140 High SDF1 is associated with low-grade myelodysplastic syndromes.
21802105 Here, the authors demonstrated in two different assay systems that His-tagged MC148R1 of Molluscum contagiosum virus displaces the interaction between CXCL12alpha and CXCR4.
21781514 The concentrations of SDF-1, IL-17 and the percentage of eosinophils were increased in asthma group compared with control subjects.
21774929 Progestins have inhibitory effects on E(2)-induced VEGF and SDF-1 in endometrial stromal cells
21757744 Ubiquitin and the cognate CXCR4 ligand stromal cell-derived factor (SDF)-1alpha do not share CXCR7 as a receptor.
21753787 we observed a significant correlation in the mRNA expression and the CXCL12 promoter DNA methylation..
21740294 Data suggest that the therapeutic efficacy by CXCR4 antagonists appeared to involve interference with the tumor-promoting signals delivered by CXCL12.
21705836 gene polymorphism at position 801 G/A is not associated with myasthenia gravis
21705626 SDF-1/CXCR4 signaling does not require phospholipase C-gamma1 to mobilize calcium, activate N-Ras, K-Ras, or ERK kinase, or internalize CXCR4 chemokine receptor
21695171 17-beta-estradiol-regulation of the CXCL12 axis components and their involvement in the growth of breast cancer cells
21667221 Genetic polymorphisms of SDF1 with low allele frequencies are associated with less HIV-1 pathogenesis.
21643956 The CXCL12 G801A polymorphism may be a low-penetrant risk factor for developing breast cancer.
21633638 CXCR4/SDF-1 axis is involved in lymph node metastasis of gastric carcinoma.
21624427 Studies indicate that CXCR4 and stromal-cell-derived factor 1alpha axis play a significant role in stem cell mobilization.
21623830 data suggest that the SDF-1/CXCR4 signalling could be used to manipulate the human fertilization, to improve both the outcome of physiological or assisted reproduction, and to develop new contraceptive methods, by development of SDF1 or CXCR4 antagonist
21618080 The CXCL12/CXCR4 signaling pathway is arguably the most conserved mechanism in directing stem cell migration in the embryo and adult mammals. (Review)
21607655 Our results demonstrate that altered expression and distribution of SDF-1/CXCR4 in MSCs may contribute to SDF-1 deficiency in the plasma of AML patients.
21607621 No significant association between the SDF-1 and CXCR4 polymorphisms and endometrium cancer risk.
21602126 CCR5delta32, CCR2-64I and SDFl-3 A gene polymorphisms do not show strong correlations to HIV-1 infection in the Chinese population.
21592819 Data show that allele A is associated with low expression of CXCL12 in the peripheral blood from ER-positive breast cancer patients, which suggests implications on breast cancer clinical outcome.
21584490 Expression of the CXCL12 (SNP rs1801157) polymorphisms GA/AA significantly correlated with distant metastasis (P=0.026), but not with prognosis.
21567400 The effect of SDF-1 on colorectal iscer cell signaling and urokinase-type plasminogen activator (uPA) expression is mediated by the CXCR4/beta1 integrin axis.
21527066 The expressions of CXCL12/CXCR4 and CXCL16/CXCR6 were significantly higher in epithelial ovarian carcinomas than in normal epithelial ovarian tissues or benign epithelial ovarian tumors. The expression of CXCL12 was related to the occurrence of ascites.
21521526 data show that in the setting of hypoxia and CXCR4 up-regulation in Treg, CXCL12 expression may have the negative consequence of enhancing Treg recruitment and suppressing the anti-tumour immune response.
21518481 SDF-1 and CXCR4 express at a high level in children with AL, which closely relates with the type of leukemia and the migration and infiltration of leukemia cells in bone marrow.
21506920 Pathogenesis of the WHIM syndrome is mediated by CXCR4 hyperfunction, leading to increased responsiveness to its unique ligand CXCL12 (also known as SDF-1). (Review)
21487523 The trophoblast cell-derived CXCL12 does not only increase the cell invasiveness in an autocrine manner, but also controls the over-invasion of trophoblasts through promoting CD82 expression in decidual stromal cells in a paracrine manner
21484857 SDF-1alpha, IL-1beta, and IL-6 are expressed in the inflamed human subacromial bursal tissues in patients with subacromial bursitis.
21470957 protection of AGT and resistance to nitrosamine-induced genotoxicity critically depends on GSNOR in hepatocytes
21465475 These findings serve to elucidate the urokinase-type plasminogen activator (uPA) and uPA receptor downstream signaling, providing new insight into the function of uPA in hepatocellular carcinoma cells.
21463876 Interaction between carcinoma-associated fibroblasts and tumor epithelial cells through the CXCL12/CXCR4 axis plays a role in non-small cell lung cancer tumor proliferation.
21459858 implications for the binding of CXCL12 and gp120 of HIV-1 at 'site 2' of CXCR4 are of great value for understanding the signal transduction via the receptor
21459858 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
21444670 prostate adenocarcinoma tumorigenesis requires a mix of -beta responsive and nonresponsive stromal cells and SDF-1
21442287 positive ratios of CXCR7, CXCL12 and CXCL11 in oral leukoplakia and oral squamous cell carcinoma tissues respectively, were significantly higher than that in normal epithelia
21440782 stromal cell-derived factor-1-3'A polymorphism has a role in mobilization of hematopoietic stem cells CD34+ in Tunisian population
21435112 Increased levels of circulating SDF-1alpha and CD34+ CXCR4+ cells may play an important role in the vasculogenesis of moyamoya disease.
21410972 CXCL12 production by malignant epithelial cells precedes tumorigenesis but is not a valuable prognostic factor in itself.
21396623 Besides overall immune health, host genetic factors influence mortality, retinitis progression, and retinal detachment in patients with AIDS and CMV retinitis that are receiving HAART.
21372218 Data show that SDF1alpha, c-kit(+) CEPs and c-kit(+) CEP ratio significantly correlated with the E7080 therapeutic effect.
21367627 Data indicate that high expression levels of SDF-1, VEGF, and MMP-9 are more correlated with lymph node metastatic prostate carcinoma compared with non-lymph-node metastatic cancer.
21361865 No statistically significant association between SDF1 genotype and HIV-1 susceptibility was detected in meta-analysis which included 13 studies with 2421 cases and 3283 controls.
21357602 CXCL12 expression in the endometrium does not alter during the menstrual cycle.
21349998 Studies indicate that CXCL12 binds to CXCR4 and CXCR7 and promote cell survival.
21349176 A comparative CXCL12/CXCR4 expression analysis was performed to assess the effect of external CXCL12 stimulation on migration of CRC cells without and with CXCR4 inhibition.
21312072 Hugh serum SDF-1 is associated with pleural metastasis in non-small cell lung cancer.
21304904 The allelic variation of recipients, however, was not associated with graft loss. A donor-derived genetic polymorphism of SDF1 has influenced the graft outcome.
21298365 CXCL12 G801A polymorphism is associated with an increased risk of benign salivary gland tumors.
21296802 the A allele of CXCL12 polymorphism rs1801157 is a possible risk factor for developing premature ovarian failure in Chinese women
21292343 there is a significant association between the polymorphisms of CXCL12 and CXCR4, and the susceptibility to and prognosis of non-small cell lung cancer
21257825 Stromal-derived factor-1(alpha) (and stem cell factor) correlate with an increase in endothelial progenitor cells early in ischemic stroke patients.
21186999 This review presents current knowledge of the mechanisms through which SDF-1/CXCR4 signaling promotes restoration of hematopoiesis by regulating the homing and engraftment of hematopoietic stem/progenitor cells.
21182836 Results show a positive correlation between CXCL12 signaling and Slug activity, thus corroborating the role of these two proteins in bone cells.
21179442 miRNA886-3p has a role in modulating the expression of CXCL12, a gene product with a critical role in hematopoietic regulation
21158728 discuss the different aspects of CXCL12/CXCR4 biology as well as the development and anti-cancer/stem cell mobilizing activity of CXCR4 antagonists
21148034 Novel molecular mechanisms permit SDF-1 to stimulate the trafficking of chemokine receptor CXCR4 specifically into Rab11-oncogene family protein recycling T-cell endosomes.
21147466 Autocrine signaling activated by CXCL12-engagement of its receptors controls motility and survival of HPV infected cells
21132258 SDF-1 as a novel mediator of endothelial progenitor cells trafficking during the menstrual cycle
21091093 Gastric cancer risk was not associated with single nucleotide polymorphisms in a chemokine ligand (CXCL12) and chemokine receptor (CCR2, CCR5, CX3CR1) genes or one frameshift deletion (CCR5).
21087507 Experiments revealed an increase in SDF-1 gene expression both in vivo and in vitro when MCF-7 cells were cultured with hMSCs.
21082982 CXCL12 interaction with CXCR4 receptor results in effects as varied as cell migration, proliferation and survival or apoptosis (Review)
21080209 Enoxaparin (LMWH) inhibits the formation of hepatic metastasis of colon cancer by disrupting the interaction of CXCR4 and CXCL12.
21071025 SDF-1, as well as VEGF, may play an important role in follicular growth and development.
21059341 NF-kappaB-regulated CXCL12/CXCL4 autocrine system is essentially involved in the invasiveness of ovarian cancer.
21041659 The establishment of the self-sustaining TGF-beta and SDF-1 autocrine signaling gives rise to tumor-promoting carcinoma-associated fibroblasts myofibroblasts during tumor progression.
20971364 Observational study of gene-disease association. (HuGE Navigator)
20970672 Multiple regression analyses, considering patient age/gender, number of transplanted CD34 cells, and CXCL12-3'A allele, confirmed the independent association of the CXCL12-3'A allele with granulocyte and platelet recovery after transplantation
20970672 Observational study of gene-disease association. (HuGE Navigator)
20967243 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
20929726 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
20923761 TNF-induced classical NF-kappaB signaling up-regulates RelB expression that inhibits both basal and NC NF-kappaB-dependent CXCL12 expression.
20889568 Results indicate a surprising, protective role for SDF-1 in retinal detachment.
20887389 CXCR7: a new SDF-1-binding receptor in contrast to normal CD34(+) progenitors is functional and is expressed at higher level in human malignant hematopoietic cells.
20877573 CXCL12 chemokine regulates colorectal carcinoma cell anoikis through bim-mediated apoptosis.
20869048 SDF-1 secreted from stromal cells may play a role in endometrial epithelial cell growth in the paracrine system
20865359 Down-regulation of CXCL12 is associated with colorectal cancer progression.
20854168 These data indicate that SDF-1 is a key neuroprotective cytokine secreted by CD133-derived multipotent stromal cells that protects mouse neural progenitor cell through CXCR7.
20851290 Observational study of gene-disease association. (HuGE Navigator)
20835359 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
20817073 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
20802378 Observational study of genetic testing. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20728717 Lipopolysaccharides reduced the expression of SDF-1a in dental pulp stem cells (DPCs); hypoxic DPCs expressed low levels of SDF-1a as well.
20725607 Observational study of gene-disease association. (HuGE Navigator)
20695076 loss of components of the CBM complex in HNSCC can inhibit SDF-1 alpha induced phosphorylation and degradation of IkappaBalpha.
20694560 Observational study of gene-disease association. (HuGE Navigator)
20661426 Data provide evidence that the tumor suppressor, programmed cell death factor 4 (PDCD4), is a previously unidentified phosphorylation target of CXCL12 signaling in all Chronic Lymphocytic Leukemia cells probed.
20646340 CXCL12/CXCR4 axis contributes to inflammation in usual interstitial pneumonia and non-specific interstitial pneumonia (f-NSIP) by promoting the accumulation CXCR4(+) lymphocytes.
20637871 Focus on the multifaceted SDF-1/CXCR4 axis in acute leukemia and how targeting this pathway could provide potential interest to eradicate the leukemia stem cells.
20634887 The chromatin modifications were determined at five PRC2 targets commonly underexpressed in multiple myeloma (CIITA, CXCL12, GATA2, CDH6 and ICSBP/IRF8). The selected genes were confirmed to be underexpressed in MM compared to normal plasma cells.
20631377 SDF1 transcriptional up-regulation after ionizing radiation is mediated by both HIF1A dependent and -independent mechanisms in endothelial cells.
20629629 As described in detail in this review, the CXCR4/CXCL12 interaction produces pleiotropic effects in stem cells and plays a pivotal role in several processes related to development, tissue regeneration and development/progression of malignancies.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622326 Genetic polymorphism of SDF1 3A could influence the therapeutic efficacy of captopril in Chinese hypertensive patients.
20622326 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622011 Study show the formation of hetero-oligomeric complexes between this viral BILF1 and human CXCR4. BILF1 impaired CXCL12 binding to CXCR4 and, consequently, also CXCL12-induced signaling.
20609598 This study was undertaken to identify potential mechanisms of regulation of CXCL12 gene expression by human fibroblasts under normal or inflammatory conditions.
20603037 Observational study of gene-disease association. (HuGE Navigator)
20585996 Based on literature searches and our experimental findings, we present a hypothesis that hUCBDSCs, secreting high level of SDF-1, modulated the expression of PECAM-1 of MKs, to regulate the megakaryocyte development.
20585037 CXCL12 increases primary tumor angiomyolipoma (AML) cell growth in vitro, exerts a survival influence, protects the cells from apoptosis, and does not affect the migration of AML cells.
20563655 stromal derived factor-1 (SDF-1) and chemokine receptor (CXCR4) have roles in bone metastasis of renal carcinoma
20563451 the detection of SDF1-3'A allelic frequency in the Brazilian population could give support to the improvement of methods to aid diagnosis, classification of disease status, and provide means to delineate therapeutic strategies.
20563451 Observational study of genotype prevalence. (HuGE Navigator)
20558135 these results demonstrate that Akt, ERK and p38 signal transduction pathways may be involved in SDF-1-mediated migration of umbilical cord blood mesenchymal stem cells.
20540706 This review explores the chemokine CXCL12/receptor CXCR4 signalling pathways that regulate cellular processes under chemotherapy-treated conditions.
20536507 Observational study of gene-disease association. (HuGE Navigator)
20531015 Observational study of gene-disease association. (HuGE Navigator)
20530467 Observational study of gene-disease association. (HuGE Navigator)
20518834 No associations were found between maternal genetic polymorphisms in CCR5 (59029G/A, 59353T/C, 59356T/C, 59402G/A and mother-to-child HIV-1 transmission; plasma, cervical and breastmilk viral loads; or breastmilk chemokine concentrations.
20518834 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20501749 The current review explores the different biological properties of CXCL12 and discusses the implications of CXCL12-based therapies for autoimmunity and cancer diseases.
20497701 SDF-1 protein is highly expressed in both the vitreous and preretinal membranes of PDR patients; SDF-1 may be correlated with VEGF in angiogenesis in PDR.
20494937 CXCL-12, a highly potent chemoattractant for hematopoietic stem cells secreted by osteoblasts, is readily digested by cathepsin X.
20484957 Pancreatic stellate cells can secrete SDF-1 and increase the invasion of pancreatic cancer cells through the SDF-1/CXCR4 axis. and IAP.
20462600 The chemotactic interaction between CXCR4 and its ligand CXCL12 may be a critical event during the progression of pancreatic cancer.
20442634 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20414828 in the presence of platelet thrombi, CD34 (+) progenitor cells phagocytize platelets in an SDF-1 dependent manner, causing their differentiation into macrophages and then foam cells
20411675 Observational study of gene-disease association. (HuGE Navigator)
20406099 investigation did not support the CXCL12-3'A gene variant as a risk factor for breast cancer incidence in a sample of the Polish population.
20406099 Observational study of gene-disease association. (HuGE Navigator)
20392929 CXCL12-induced chemotaxis mainly requires Ca2+ transients and IKCa activity and involves the upregulation of IKCa current density in responsive glioblastoma cells.
20388788 proteolytic degradation of CXCL12 is characteristic of both PV and PMF; truncated forms of CXCL12, in addition to the reduced expression of CXCR4 by CD34(+) cells, lead to a profound mobilization of HSC/HPC in PMF
20383584 SDF-1alpha inhibits hypoxia/serum deprivation induced bone marrow-derived mesenchymal stem cell apoptosis through PI3K/Akt and ERK1/2 signaling pathways.
20362069 These results demonstrated a regulatory role of SDF-1 in BMP2-induced osteogenic differentiation of mesenchymal stem cells.
20348095 Calcium mobilization triggered by the chemokine CXCL12 regulates migration in wounded intestinal epithelial monolayers.
20331475 CD3/CD28-stimulation inhibited CXCL12-mediated migration of peripheral blood.
20305788 TSAd, through its interaction with both Itk and Lck, primes Itk for Lck mediated phosphorylation and thereby regulates CXCL12 induced T cell migration and actin cytoskeleton rearrangements
20299965 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20206813 Report the angiogenic effects of stromal cell-derived factor-1 (SDF-1/CXCL12) variants in vitro and the in vivo expressions of CXCL12 variants and CXCR4 in human critical leg ischemia.
20198315 Observational study of gene-disease association. (HuGE Navigator)
20196627 the VEGF-stromal cell-derived factor-1alpha/CXCL12 axis may have a role in pleural effusion of lung cancer
20182908 the platelet content of VEGF-A in cancer patients was significantly increased compared to healthy controls, while thrombospondin-1, CXCL12 and CXCL4 were significantly decreased
20181695 These results suggest that CXCL12 production by DCs resident in lymph nodes represents an antiviral mechanism in the context of the infectious synapse that could account for the delayed appearance of X4 viruses.
20181695 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
20177796 Stromal CXCR4 and CXCL12 expression is associated with distant recurrence and poor prognosis in rectal cancer after chemoradiotherapy.
20177148 Conditioned medium (CM) from the OVCAR-3 and SKOV3 ovarian cancer cell lines stimulated secretion angiogenic factors such as stromal-derived factor-1 alpha (SDF-1 alpha) and VEGF from adipose tissue-derived mesenchymal stem cells.
20163833 Observational study of gene-disease association. (HuGE Navigator)
20145264 T cells from ZAP-70 protein tyrosine kinase-negative samples show significantly less migration towards CXCL12 compared to T cells from ZAP-70-positive samples.
20141446 Am80 inhibits surface CXCR4 expression and SDF-1-induced chemotaxis by the acceleration of CXCR4 internalization via activation of conventional PKC
20134207 We hypothesize a presumptive role for CXCL12 and its receptor, CXCR4, in the thymus involution.
20133349 Plasma levels of SDF-1 and PlGF were significantly elevated in patients with antiphospholipid syndrome than in controls, regardless of the arterial/venous nature of the thrombosis
20118565 role of SDF-1 and its receptor CXC chemokine receptor 4 (CXCR4; ie, the SDF-1/CXCR4 system) in the pathophysiology of myocardial infarction
20109310 expression up-regulated in polyp tissue of chronic rhinosinusitis
20109227 Study shows a simultaneous involvement of epigenetic regulation for both CXCL12 and ESR1 genes in Brazilian women. Methylation status of both genes was significantly correlated with histologically advanced disease, the presence of metastases and death.
20104779 The SDF-1alpha transcription was significantly up-regulated during late stage of HIV infection.
20102637 Chondrosarcoma cell invasion is increased by hypoxia induced expression of CXCR4 and MMP1 and is mediated by HIF-1a and ERK.
20088916 ex vivo expansion of hematopoietic stem cells may be highly effective through osteoblast-differentiated mesenchymal stem cells acting as a feeder layer, and likely operates through the CXCL12 signaling pathway
20084476 The interaction of SDF-1alpha and CXCR4 plays an important role in pulmonary cellular infiltration during differential syndrome
20077567 These observations indicate that CXCL12 contains genomic and structural elements characteristic of both CXC and CC chemokines.
20072657 Data show that a significant increase in plasma SDF-1alpha, and an immediate decrease in plasma VEGF and FGF levels after chemotherapy.
20067991 SDF-1alpha/CXCR4 axis is a novel upstream pathway of FASN expression and is associated with mediating its prosurvival effect.
20038229 Meta-analysis of gene-disease association. (HuGE Navigator)
20036838 Studies indicate that CXCR7 is an interceptor for CXCL12 and CXCL11.
20028644 Increased SDF-1alpha levels in mid-trimester amniotic fluid suggest a possible role in predicting pregnant women at risk of adverse neonatal outcomes including higher preterm birth rate, lower birth weight, and lower Apgar scores.
20025867 Bone marrow stem cell migrate to vascular endothelial cells via SDF-1alpha/CXCR4 signaling.
20020198 SDF-1 status is a significant prognostic factor and may be clinically useful for assigning adjuvant therapy to patients with ER-positive invasive breast cancers.
20018929 we were able to show a significant increase in BM SDF-1 levels in patients with hematologic malignancies, being treated with nonmyeloablative or myeloablative conditioning regimens
20015995 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
20015878 Aberrant CXCL12 expression in multiple myeloma cells is regulated by hypoxia-inducible factor-2.
19958843 Observational study of gene-disease association. (HuGE Navigator)
19942750 Data show that genotype frequencies of CCR2, MCP-1 and DC-SIGN polymorphisms did not differ significantly between the study groups, but a significantly increased frequency of SDF-1alpha polymorphism was observed among HIV+PTB+ patients.
19942750 Observational study of gene-disease association. (HuGE Navigator)
19927352 The single-nucleotide polymorphism (SNP) rs1801157 in CXCL12/SDF1 gene was assessed in breast cancer, Hodgkin's lymphoma (HL), and non-Hodgkin's lymphoma.
19927352 Observational study of gene-disease association. (HuGE Navigator)
19923906 CXCL12 promotes motility and proliferation of glioma cells.
19921580 Shikonin may also play a role in anti-metastasis via down-regulating the expression of CXCR4 and reducing the CXCL12-induced migratory response in colorectal carcinoma cells.
19917679 Modulation of CXCL12-mediated responses of CD34(+) cells by CCR5 chemokines provides a possible mechanism that underlies movement of hematopoietic stem/progenitor cell during inflammation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19885584 CXCR4 nuclear localization follows binding of its ligand SDF-1 and occurs in metastatic but not primary renal cell carcinoma
19878731 These results showed increased expression of SDF-1a in interstitial pneumonias associated with collagen vascular disease, suggesting different angiogenic procedures
19851296 Observational study of gene-disease association. (HuGE Navigator)
19837984 Results describe the interaction between the full-length CXCR4 and SDF-1.
19834823 SDF1-3'A variant may be associated with an increased risk of laryngeal cancer.
19834823 Observational study of gene-disease association. (HuGE Navigator)
19826912 SDF1-3' G801A genotype may be associated with some clinical manifestations in patients with systemic lupus erythematosus.
19826912 Observational study of gene-disease association. (HuGE Navigator)
19826039 Higher SDF1alpha plasma levels during bevacizumab treatment significantly associated with distant metastasis in rectal cancer.
19825996 Our results suggest that the phenotypic knockout strategy of CXCR4 using a novel recombinant protein TAT/54R/KDEL might be a possible approach for inhibiting relative tumor metastasis mediated by CXCR4/CXCL12 interaction.
19821058 The present study showed a significant association between the SDF1-3'A polymorphism and myocardial infarction in Chinese Han population.
19821058 Observational study of gene-disease association. (HuGE Navigator)
19816012 Elevated circulating SDF-1 levels occur in patients with sicle cell disease and may play a role in the pathophysiology of SCD-related pulmonary hypertension.
19808652 This study robustly links increased CXCL12 expression and FoxP3(+)-cell infiltration to human papillomavirus infection and progression of cervical cancer.
19794961 Data show that beta-arrestin 2 increased uptake of CXCL12 in cells expressing CXCR7, emphasizing the functional relevance of the interaction between CXCR7 and beta-arrestin 2.
19788587 CXCL12 variants may play a role in risk of cervical carcinoma
19774645 Upregulation of CXCL12 is associated with inflammatory bowel disease.
19773382 Elevated CSF levels of CXCL12 and CXCL13 measured in seven CNS lymphoma patients during therapy decreased in five patients who responded to chemotherapy and increased in two with lymphoma progression.
19765831 CXCL12 is expressed in human brain microvessel endothelial cells and has an important role in T cell subset recruitment across the blood-brain barrier in central nervous system inflammation.
19745163 Shear stress inhibits homocysteine-induced stromal cell-derived factor-1 expression in endothelial cells.
19718053 Activation of Cdc42 GTPase through p210(Bcr-Abl) tyrosine kinase signaling in CML cells contributes to defects in SDF-1alpha-chemotactic response due to desensitization of the actin polarization signal required for directional migration.
19717493 Glycosaminoglycans mimetics may compete with cellular heparan sulfate chains for the binding to SDF-1/CXCL12 and may affect heparanase expression, leading to reduced SDF-1/CXCL12 mediated in vitro chemotaxis and growth of hepatoma cells.
19700239 glioblastoma cells may be attracted by endothelial cells, enhancing their proliferation and underlines the importance of SDF-1, cathepsin B and MMP-9 in the cross-talk between these cells in normoxic conditions
19695308 Targeting the glycosaminoglycan/chemokine interaction could be a new therapeutic approach for carcinomas in which SDF-1/CXCL12 is involved.
19692460 Data demonstrate that human uNK cells release chemokines, including CXCL12, with anti-HIV-1 activity for X4-tropic strains and this suggest that these chemokines may contribute to the inhibition of X4-tropic strain transmission across mucosal tissues.
19672298 combination of SDF-1, PTN, IGF2, and EFNB1 mimics the DA phenotype-inducing property of SDIA and was sufficient to promote differentiation of hESC to functional midbrain DA neurons
19669591 Observational study of gene-disease association. (HuGE Navigator)
19661268 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
19660434 PI3Kgamma regulates tumor cell adhesion through activation of CXCL12.
19654580 CD26 expression on T cell lines increases SDF-1-alpha-mediated invasion.
19646633 Observational study of gene-disease association. (HuGE Navigator)
19641037 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
19639049 Significantly lower serum concentration of CXCL-9, CXCL-10, CCL-17, and IL-18 and higher concentration of CXCL-12 and CCL-27 were found in atopic dermatitis patients under 10 years old when compared to Control.
19615279 SDF-1alpha was strongly expressed in normal superior deep cervical lymph nodes, bone marrow, lung and liver but absent or very poor expression in inferior deep cervical lymph nodes, kidney and colon tissues in patients with nasopharyngeal carcinoma.
19615218 CXCL12 was mainly located in the normal pancreatic cell envelopes and/or cytolymphs, not in pancreatic adenocarcinoma tissue.
19605814 expression in colorectal cancer cells and at sites of budding were significant prognostic factors.
19601773 CXCL12beta 3'A polymorphism, previously associated with resistance to AIDS progression and other diseases, leads to increased levels of CXCL12 mRNA; results presented here demonstrate that this effect is a consequence of an enhanced mRNA stability
19568410 the CXCR4 ligand CXCL12 is expressed by endothelial cells and likely Kupffer cells lining the liver sinusoids of liver metastatic human HEP-G2 hepatoma and HT-29LMM colon cancer
19563077 Arrest of CXCR4 can inhibit liver metastasis of colon cancer through blocking cell proliferation and migration induced by SDF-1.
19559392 Observational study of gene-disease association. (HuGE Navigator)
19551455 The substantia nigra of parkinson disease subjects exhibited higher expression of CXCl12 expression than control subjects.
19550128 Data show that CXCL12/CXCR4 is intensively expressed in esophageal squamous cell carcinoma, and the level of CXCR4 is positively correlated to progression and prognosis of ESCC.
19526283 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
19523923 SDF-1alpha/CXCR4 axis involves in cyclic stretch -mediated cellular functions in human saphenous vein smooth muscle cells.
19521120 HGF has a direct effect on glioma cell proliferation and invasion. HGF up-regulates SDF-1 and CXCR4 mRNA expression and contributes to cell invasion.
19520808 Wnt5A is a critical mediator of CXCL12-CXCR4 signaling and migration in human and murine T
19513623 The SDF-1/CXCR4 axis played a critical role in the metastasis of human ovarian cancer by increasing the adhesion capability of cancer cells and the activity of MMP-2 and MMP-9 via ERK1/2 signaling pathway.
19508998 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19501493 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19500134 primary myeloma cells exhibit constitutively lower CD54 that might be partially regulated by CXCL12, and their localizations in the BM may be associated with the expression levels of CD54
19497995 The rate of breast cancer-specific mortality was much higher in patients with both high p-CXCR4 expression and low plasma SDF-1 levels
19496172 SDF-1alpha acts through CXCR4 to activate MEK and ERK, which in turn activates IKKalpha/beta and NF-kappaB, resulting in the activations of alphavbeta3 integrins and contributing the migration of human osteosarcoma cells.
19476565 CXCR4, a G-protein-coupled receptor with a unique ligand, CXCL12, may be involved in the pathogenesis for type 1 diabetes.
19472013 SDF-1alpha G801A polymorphism is associated with lymph node metastasis in stage T3 colorectal cancer
19472013 Observational study of gene-disease association. (HuGE Navigator)
19460858 AR can utilize the CXCL12/CXCR4 axis through induction of KLF5 expression to promote prostate cancer progression
19443661 role of RhoA and Rac1 GTPases in SDF1-induced adhesion, chemotaxis, and homing of multiple myeloma cells to the bone marrow
19438749 This study suggests that up-regulation of cytoplasmic expression of SDF-1 might be one of the molecular mechanisms facilitating lymph node metastasis of invasive micropapillary carcinoma .
19409379 Results suggest that hERG1 K(+) channels are functionally linked to cell migration induced by stromal cell-derived factor-1.
19394082 CXCL12 (-801AA) genotype was more frequent in WM patients compared with control subjects (p = 0.01). On the other hand, CXCL12 (-801GG) patients had a shorter median survival after initiation of first line therapy than remaining patients
19394082 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19381432 Homozygous carriers of the SDF-1 3'A genotype are more frequent in diabetes patients with proliferative retinopathy.
19381432 Observational study of gene-disease association. (HuGE Navigator)
19379578 Umbilical cord blood-derived stromal cells may play an important role in secreting high levels of SDF-1 and regulating megakaryocyte expression of CXCR4.
19373784 SDF-1-3'A gene polymorphism may be considered as a factor of increased susceptibility to oral cancer in Taiwanese.
19373784 Observational study of gene-disease association. (HuGE Navigator)
19372622 The serum SDF-1alpha level is independently predictive of an increased level of circulating endothelial progenitor cells [defined by staining markers: CD31/CD34 (E(1)) and KDR/CD34 (E(2))].
19342158 SDF-1, which was secreted by Saos-2 cells, played an important role in the migration of human mesenchymal stem cells injected into nude mice.
19339694 -A-induced migration depends on the selective and polarized release of 2 chemokines, namely CXC chemokine ligands 12 and 14
19336886 CXCL12/CXCR4 signaling in glioma cells may be another mechanism for these cells to express plasminogen activator inhibitor-1
19335218 Targeted disruption of the CXCL12/CXCR4 axis inhibits osteolysis in a murine model of myeloma-associated bone loss.
19327121 SDF-1-3'A gene polymorphism could be considered as a factor related to an increased susceptibility to the risk and pathological development of hepatocellular carcinoma
19327121 Observational study of gene-disease association. (HuGE Navigator)
19307591 identification of an intricate SDF-1alpha-induced signaling cascade that involves eNOS, JNK3, and MKP7and enhances endothelial migration
19302975 CXCR4/SDF-1 pathway was critical for TLR9 agonist to enhance the metastasis of human lung cancer cells.
19295169 novel inhibitory effects of phosphoinositides and SDF-1alpha on Kv1.3 current may have a significant function as a downregulation mechanism of Kv1.3 activity for the maintenance of T lymphocyte activation in immune responses
19289100 epigenetic regulation of SDF-1 was studied to determine if it is involved in the mechanism responsible for the differential expression of SDF-1 in two types of vascular cells, brain microvascular endothelial cells and pericytes.
19285061 results demonstrate a mechanism linking SDF-1alpha and IL-6, and provide additional support for the notion that SDF-1alpha plays a regulatory role in microglia activation
19282275 Elevated plasma stromal cell-derived factor 1 expression can be used to predict pelvic inflammatory disease.
19282275 Observational study of gene-disease association. (HuGE Navigator)
19280118 Upregulation of stromal cell-derived factor-1 expression is associated with pituitary adenoma.
19263529 Observational study of gene-disease association. (HuGE Navigator)
19260802 SDF-1alpha/CXCR4 chemoattraction system can be used to efficiently recruit bone marrow stromal cells into SDF-1alpha-releasing 3 dimensional scaffolds in vitro and in vivo.
19252530 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19215683 SDF-1alpha and vascular endothelial growth factor are expressed in human intervertebral discs
19199057 CXCR4-CXCL12 axis can play a role in the progression of endometrial carcinoma and that specific therapies with antagonists of chemokines receptors could be of help in the treatment of metastatic patients.
19198609 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19196101 associated the potential combined CXCL12-related SNPs with genotypes that were protective against breast cancer, and that may contribute to identification of a low-risk population for the development of breast cancer
19196101 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19139298 Robust expression of CXCR4/CXCL12 on inflammatory elements in MS lesions highlights a role of this chemokine/receptor pair in central nervous system inflammation.
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19124913 Observational study of gene-disease association. (HuGE Navigator)
19115008 SDF1 gene variation (rs2297630) has an influence on SDF1alpha level and circulating EPC number, and that plasma SDF1alpha level is a predictor of endothelial progenitor cell number.
19115008 Observational study of gene-disease association. (HuGE Navigator)
19082444 Evaluation of CXCL12 expression is useful for determining tumor properties, including nodal metastasis and prognosis in patients with esophageal squamous cell carcinoma
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064579 Observational study of gene-disease association. (HuGE Navigator)
19059114 CXCL12 induces iNOS expression in human CD8 T cells and this response may contribute to allograft rejection.
19035451 PaCa-derived CXCL8 and fibroblast-derived CXCL12 and corresponding receptors CXCR2 and CXCR4 cooperatively induce angiogenesis in vitro by promoting HUVEC proliferation, invasion, and tube formation
19032065 Observational study of genotype prevalence. (HuGE Navigator)
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019853 These data suggest that oncostatin M might play a key role in repair and tissue regeneration via the induction of stromal cell derived factor 1.
19017978 RGS13 overexpression inhibited CXCL12-evoked Ca(2+) mobilization, Akt phosphorylation and chemotaxis.
19013212 A CXCL12 transfectant-specific increase in the pro-survival factor Mn-SOD, which is considered important for the inactivation of reactive oxygen species, thereby prolonging cell survival.
18974840 Observational study of gene-disease association. (HuGE Navigator)
18954561 CXCR4 and CXCL12 may play an important role in the metastasis of HCC by promoting the migration of tumor cells.
18954402 In patients transplanted with a relatively lower CD34+ cell dose who achieved fast engraftment, a higher responsiveness to SDF-1 and high CI could have compensated for the lower cell dose
18949410 gastric cancer, CXCL12/ CXCR4 axis seems to be more strongly associated with lymphatic or hematogenous metastasis than the establishment of peritoneal deposits
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18930992 The SDF1-3'A allele is significantly associated with microvascular involvement in SSc.
18930992 Observational study of gene-disease association. (HuGE Navigator)
18928845 plays an important role in the process of pulpal inflammation via the recruitment of CXCR4-expressing inflammatory cells
18928397 SDF1- 3'A was associated with a high risk of HIV-1 infection through sexual transmission in Han Chinese.
18928397 Observational study of gene-disease association. (HuGE Navigator)
18924211 essential role of dermis-derived CXCL12 in initiating migration of maturing human LC to the dermis thus permitting their further journey to the draining lymph nodes.
18855658 Observational study of gene-disease association. (HuGE Navigator)
18851783 CXCR4/SDF-1 participates in tumor invasiveness and metastasis in cervical cancer through regulating the adhesion ability by activating the MAPK signaling transduction pathway and promoting secretion of MMP-2.
18845960 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18836306 CXCR4/SDF-1 interaction blockade in prostate cancer cells by hTERT promoter induces CXCR4 knockdown and prevents metastasis
18829537 Slits are negative regulators of Sdf1 and Cxcr4 in breast cancer cells.
18814143 SDF-1alpha enhances the invasiveness of chondrosarcoma cells by increasing alphavbeta3 integrin expression through the CXCR4/ERK/NF-kappaB signal transduction pathway.
18802065 SDF-1alpha stimulates migration of monocytes through its receptor, CXCR4, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta2 integrins.
18799424 CXCR4 bridged the SDF-1 dimer interface so that sulfotyrosines sTyr7 and sTyr12 of CXCR4 occupied positively charged clefts on opposing chemokine subunits.
18788547 SDF-1alpha accelerated the proliferation and the migration of dental pulp cells which expressed CXCR4.
18781098 the CXCL12/CXCR4 system may play a role in tumor cell spread to lymph nodes and also in neoplastic development.
18775666 DC-SIGN, DC-SIGNR and SDF-1 polymorphism was detected in high risk seronegative and HIV-1 patients in Northern Asian Indians.
18775666 Observational study of gene-disease association. (HuGE Navigator)
18774952 Mn2+ regulates myeloma cell adhesion differently than the proadhesive cytokines HGF, IGF-1, and SDF-1alpha
18774388 Observational study of gene-disease association. (HuGE Navigator)
18763111 Observational study of genotype prevalence. (HuGE Navigator)
18760839 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
18760838 S1P(1) acts as an inhibitor of CXCR4-dependent migration of hematopoietic cells to sites of SDF-1 production.
18757300 stromal cell-derived factor-1 and transforming growth factor-beta control the quiescence/cycling switch of CD34(+) progenitors through FoxO3 and mammalian target of rapamycin
18709948 Vitreous levels of both SDF-1 and VEGF in patients with proliferative diabetic retinopathy are significantly higher than those of nondiabetic patients.
18709383 Microvasculature endothelial cells are potential contributors for generation of SDF-1 in ischemic retina.
18707241 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
18698020 and SDF1 are overexpressed in human pituitary adenomas
18692524 the results suggest a new function of CXCL12 in the human thymus controlling the survival and functionality of thymic DCs
18687671 CXCL12 secreted by human trophoblasts enhances the coordination between trophoblasts and DSCs, via the regulation of MMP9 and MMP2, which may improve the functional materno-fetal interface.
18670789 Down-regulation of CXCL12 mRNA expression by promoter hypermethylation is associated with metastatic progression in breast carcinomas.
18653785 The binding of CXCL12 to its receptor CXCR4 triggers Gi protein signals for motility and integrin activation in many cell types.
18648536 CXCL12gamma may represent the paradigm of haptotactic proteins that critically promote the directional migration and tissue homing of cells and regulate important homeostatic and physiopathological functions
18634924 may play a role in the recruitment of CXCR4-positive dental pulp cellss toward damaged sites
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18632989 Unique microenvironment provided by lipid rafts and their specific contribution in providing specificity to CXCL12 signaling in Jurkat cells.
18599607 Neuronal and endothelial cells exposed to VEGF up-regulated the expression of SDF-1alpha. CXCR4-positive tumor cells migrated toward a SDF-1alpha gradient in vitro, whereas inhibition of CXCR4 expression decreased their migration
18577527 Adenovirus-mediated stromal cell-derived- factor-1alpha gene transfer induces cardiac preservation after infarction via angiogenesis of CD133+ stem cells and anti-apoptosis.
18575756 The multimodular structure of CCN1 enables it to fulfill multiple functions that may contribute to the different stages of cancer development.
18563594 degradation of CXCL12 by CD26/DPPIV may be involved in the metastatic cascades of Prostate cancer.
18558091 Endogenous CXCL12 inhibits colorectal tumor metastasis through increased anoikis.
18556651 analysis of how small neutralizing molecules inhibit actions of the chemokine CXCL12
18549608 SDF-1 increases the leukemic cell adhesion, migration and survival by stimulating the PI3K pathway.
18521742 The elevated level of SDF-1alpha detected in breast cancer patients highlights the importance of this chemokine in disease progression
18512766 CXCL12 promoter hypermethylation is an early event in astrocytoma development
18502034 Breast cancer metastasis suppressor 1 inhibits SDF-1alpha-induced migration of non-small cell lung cancer by decreasing CXCR4 expression.
18487224 CXCL12 enhances Laryngeal and hypopharyngeal squamous cell carcinoma cell invasiont through paracrine-activated CXCR4, triggering MMP-13 upregulation.
18469140 Amino (NH2)-terminal processing of CXCL12 impairs synergy with CCL2 in monocyte chemotaxis.
18454663 Immunohistologic staining showed that SDF-1alpha and CXCR4 levels were elevated in samples obtained from periodontally compromised individuals.
18448868 the CXCR4/SDF-1 axis interacts with VLA-4 in regulating migration and adhesion of Waldenstrom macroglobulinemia cells in the bone marrow microenvironment
18448428 SDF-1alpha/CXCR4 may promote head and neck squamous cell carcinoma invasion and metastasis by activating NF-kappaB
18443596 Expression of SDF-1 alpha predicts lymph node (LN) metastasis in colorectal cancer (CRC).
18391751 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18386165 based on the present study SDF1-3A may be associated with the susceptibility of patients to squamous cell carcinoma of the head and neck
18386165 Observational study of gene-disease association. (HuGE Navigator)
18383856 The G801A polymorphism of the SDF-1 gene is associated with advanced stages of oral cancer.
18383856 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18365549 Overexpressions of SDF-1 in sinusoidal endothelial cells in HCC suggest that the SDF-1 pathway plays a possible role in hepatocellular carcinoma progression through neoangiogenesis
18357387 SDF-1alpha and CXCR4 expressions are possible markers of highly-invasive SCC and regulated by epithelial-mesenchymal transition.
18354239 CXCL12 was observed predominantly in infiltrated ducts and malignant B cells
18351386 Upregulation of HIF-1 alpha and its downstream targets GLUT1 and SDF-1 in colorectal adenomas and carcinomas may be due to hypoxia.
18339898 BCR-ABL1 in malignant cells constitutively increases expression of activation-dependent epitopes of LFA-1 and complete loss of responsiveness of LFA-1 to SDF-1-induced "inside-out" signaling involving CXCR4 and Lyn, leading to aberrant adhesive responses
18337451 Lipid raft-disrupting agents inhibited raft-associated CXCL12/CXCR4 transactivation of the HER2 and cellular invasion in prostate cancer cells.
18323525 ablation of PI3Kgamma reduced SDF1alpha-induced integrin activation in human EPCs and in murine Lin(-) BM-derived progenitor cells
18317966 SDF-1alpha might serve as a possible marker for predicting or monitoring distant metastasis in gastric carcinoma
18316470 This study reports on a non-canonical pathway in Tac1 activation by SDF-1alpha.
18310089 SDF-1 alpha from osteoblasts could induce release of IL-6 in human squamous cell carcinoma cells via activation of CXCR4, ERK and NF-kappaB pathway and thereby promote osteoclastogenesis.
18292939 CHK is capable of inhibiting the CXCL12-CXCR4 pathway in neuroblastoma.
18292502 Homeostatic chemokine CXCL12 triggers lymphocyte function-associated antigen-1 (LFA-1) T cell arrest on ICAM-1 under shear flow.
18292211 Cleavage of the C-terminal lysine residue of SDF-1alpha by CPM leads to attenuated chemotactic responses.
18281050 CXCR4, expressed on infiltrating lymphocytes, and CXCL12, expressed on stromal cells, is involved in the recruitment of lymphocytes within the arterial wall in abdominal aortic aneurysms
18276777 Altered patterns of CXCL12 expression at the BBB were specifically associated with multiple sclerosis.
18275857 DP8 cleavage of the N-terminal two residues of IP10 (CXCL10), ITAC (CXCL11) and SDF-1 (CXCL12), is reported.
18267010 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
18227351 RalB was found to mediate SDF-1-induced migration
18223219 study found that low plasma SDF-1 is an independent host-derived predictive marker of distant metastasis in breast cancer
18223219 Observational study of gene-disease association. (HuGE Navigator)
18206727 Altered SDF-1/CXCR4 axis in patients with primary myelofibrosis and in the Gata1 low mouse model of the disease
18205260 lack of association of SDF-1 3'A, MCP-1 (-2518), CCR5-Delta32 polymorphisms with death and hepatocellular carcinoma occurrence in cirrhotic hepatitis C-infected patients
18205260 Observational study of gene-disease association. (HuGE Navigator)
18191726 Observational study of gene-disease association. (HuGE Navigator)
18191726 data suggest that SDF-1 G801A and RANTES-28 polymorphisms are not associated with the genetic susceptibility to systemic lupus erythematosus in Mexican individuals
18097955 high APN enzyme activity may antagonize the cellular properties regulated by the CXCR4/SDF-1alpha system in embryonic kidney cells.
18086932 platelet-derived SDF-1 regulates adhesion of stem cells in vitro and promotes differentiation of CD34+ cells to endothelial progenitor cells.
18060801 The frequency of the SDF-1A allele was significantly different between cases and controls: 0.32 vs. 0.20, respectively (OR 1.81; 95% CI 1.25-2.60; p=0.007).
18060801 Observational study of gene-disease association. (HuGE Navigator)
18040858 Review highlights the differential expression of CXCR4 and CXCL12 and their importance for the temporal regulation of neuronal migration and circuit formation during development and possibly in adult neurogenesis and repair.
17982648 Observational study of gene-disease association. (HuGE Navigator)
17982648 G>A functional transition mapping the 3' untranslated region of the CXCL12 gene has been found to be under-represented among rectal cancer patients when compared to colon cancer patients.
17964973 anlalysis of levels of circulating PIGF, SDF-1 and sVCAM-1 in patients with systemic lupus erythematosus
17950696 hypoxia could inhibit the SDF-1-dependent migration of HL-60 via blocking of Akt activation.
17949547 knee synovial fluid levels of CXCL 12 were higher in Rheumatoid arthritis and Behcets disease patients compared to Osteoarthritis patients
17923814 SDF-1-CXCR4 interaction activated MMP-9 at the both transcription and protein levels and MMP-2 only at the post-translation level.
17916907 bone marrow-derived-SDF-1alpha enhances the invasiveness of lung cancer cells by increasing MMP-9 expression through the CXCR4/ERK/NF-kappaB signal transduction pathway
17914737 CXCL12 may have a role in leukaemic cell proliferation and survival during childhood ALL.
17898317 reduced migration of MDS CD34(+) cells toward SDF-1, as a result of impaired activation of the PI3K and Rac pathways and a decreased F-actin polymerization
17894415 Immunolocalization of IL-7, IL-7Ralpha, SDF-1alpha, and CXCR4 resulted in a diffuse but specific labeling. RT-PCR analysis confirmed the expression of the above-mentioned transcripts.
17878755 phosphoinositide 3-kinase/Akt/eNOS, but not mitogen-activated protein kinase/ERK, signal transduction pathway may be involved in SDF-1alpha mediated migration of endothelial progenitor cells
17846797 SDF-1alpha/CXCR4 play crucial roles in regulating the migratory potential of HPMCs, which may be involved in the re-epithelialization of denuded basement membrane at the site of peritoneal injury.
17805324 The CXCL12-G801A polymorphism did not associate with disease outcome or presence of extramedullary disease in acute myeloid leukemia.
17785557 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17785557 CXCL12 G801A polymorphism may be a risk factor for Prostate cancer.
17784832 When transfected into mice, enhances in vitro replating/self-renewal of hematopoietic progenitor cells.
17768666 the involvement of the bone marrow microenvironment and CXCR4/SDF1alpha signaling in metastasis of Rhabdomyosarcoma.
17724466 Gene silencing increases metastasis in breast carcinoma.
17706641 CXCR4 contributes to renal carcinoma cells (RCC) dissemination and may provide a novel link between CXCL12 expression and integrin beta1 triggered RCC adhesion to the vascular wall and subendothelial matrix components
17687643 prolonged Akt activation is an important signaling pathway for breast cancer cells expressing CXCR4 and is necessary for CXCL12-dependent cell migration
17681365 H4 histamine receptor mediates optimal migration of mast cell precursors to CXCL12 and plays a role in the perpetuation of allergic response.
17653799 High CXCL12 expression is associated with gastric cancer
17653321 Observational study of gene-disease association. (HuGE Navigator)
17650669 G-CSF induces hematopoietic stem cell mobilization by decreasing bone marrow SDF-1 and down-regulating CXCR4 expression.
17634424 These results suggested that, in cases of oral squamous cell carcinoma, the paracrine SDF-1/CXCR4 system potentiates lymph node metastasis, but distant metastasis might require the autocrine SDF-1/CXCR4 system.
17631494 CXCL12 may play a major role in the etiology of benign proliferative disease in the context of an aging tissue microenvironment.
17604544 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17604544 survival time of HIV-infected people with CCR2b-+/64I and SDF1-+/+ genotypes was significantly shorter than those of the other groups (p < 0.01), but this effect was not apparent in persons with CCR2b-+/64I alleles and SDF1-+/3'A genotypes
17572689 CXCL12 may function as an autocrine and paracrine mucosal signaling network regulating the competency of the epithelial barrier to withstand injury and mediate repair following damage.
17560067 RANTES and SDF1 were associated with patients suffering from leukoencephalopathies
17560067 Observational study of gene-disease association. (HuGE Navigator)
17559806 CXCR4/CXCL12 signaling axis can induce angiogenesis and progression of tumors by increasing expression of vascular endothelial growth factor through the activation of PI3K/Akt pathway
17550983 CXCL12 induces MMP-13 expression in human chondrocytes.
17532557 DNMT1 plays a key role in maintenance of methylation, and DNMT3B may act as an accessory DNA methyltransferase to epigenetically silence CXCL12 expression in MCF-7 and AsPC1 cells
17530998 Observational study of gene-disease association. (HuGE Navigator)
17530707 IL-18 has a unique role in inducing the secretion of angiogenic SDF-1alpha/CXCL12, MCP-1/CCL2, and VEGF in rheumatoid arthritis synovial tissue fibroblasts, via distinct signaling intermediates.
17510563 The CXCL12 ligand with its exclusive receptor CXCR4 has a pivotal role in the directional migration of cancer cells during the metastatic process. [REVIEW}
17507482 Results suggest that the different C termini of CXCL12 variants may contain important molecular determinants for the observed differences in antiviral effects and other biological functions.
17507482 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
17461449 These results indicated that the activation of CXCR4 and its signaling pathways (MEK1/2 and Akt) are essential for CXCL12-induced cholangiocarcinoma cell invasion.
17456315 The level of SDF-1 expression in the carcinoma patients was higher than that of the liver cirrhosis, hepatitis patients and healthy donors.
17413295 Observational study of gene-disease association. (HuGE Navigator)
17409218 NF-kappaB is involved in the repression of Tac1 at higher levels of SDF-1alpha in MCF12A. These results provide insights on the behavior of breast cancer cells as they traverse across gradient changes of SDF-1alpha.
17393416 Inhibition of the interaction between IL-17 from T cells and SDF-1 in fibroblast-like synoviocytes may provide a new therapeutic approach in rheumatoid arthritis.
17379424 Beta-catenin has a significant role in pancreatic cancer progression through interactions with SDF-1b.
17357154 structure of the refolded SDF1A monomer looks like a forefinger protruding from a closed first
17355795 The overexpression rate of CXCL12 is increasing by the progression of tumors. The chronic inflammatory cells in cervical adenocarcinoma are not attracted by CXCL12.
17340464 REVIEW of platelet-derived SDF-1 in the recruitment of progenitor cells to vascular injury areas, and its subsequent effects in atherosclerosis, vascular repair, and angiogenesis
17264079 First x-ray structure of CXC class chemokine CXCL12 in complex with glycosaminoglycans; a cluster of basic residues in the dimer interface is required for chemotaxis.
17245764 It is possible that the bcr-abl fusion gene and the SDF1 genotype for 3'A allele have important implications for the pathogenesis of CML.
17240189 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17237407 IL-10 promoter activity was ablated by mutating two nonpolymorphic binding sites for the AP-1 transcription factor, and in primary human T cells, SDF-1 costimulation enhances AP-1 binding to both of these sites
17197116 Mesenchymal stem/stromal cells transfected with CXCL12 might become a next generation cell/chemokine therapy for therapeutic neovascularization.
17174272 Taken together, these data suggest that fibrocytes are involved in the pathogenesis of human lung fibrosis.
17148615 additive neuropathogenic properties exerted by a proteolytically cleaved chemokine as consequences of a change in receptor specificity, culminating in neurodegeneration
17143542 Observational study of gene-disease association. (HuGE Navigator)
17143542 We found that the carrying rate of allele CXCL12-A was higher in colon cancer patients compared with rectal cancer patients (P=0.017). Analyses by ELISA showed that CRC patients (n=63) had a lower CXCL12 plasma level compared with controls (P<0.0001).
17119115 CXCR4 is differentially expressed at high levels in the peripheral blood and is down-regulated in the bone marrow in response to high levels of SDF-1.
17099730 An important factor in basal cell carcinoma invasiveness.
17082613 CXCL12 expression may influence tumor progression by shaping the immune cell population infiltrating lung adenocarcinoma tumors.
17075134 The model free analysis indicated that SDF-1alpha is rigid on the nano- to picosecond timescale with flexible termini.
17056591 Galpha13-Rho signaling axis is required for SDF-1-induced migration through CXCR4
17046575 The C-terminal alpha-helix of hSDF-1 has a critical role in CXCR4 stimulation. Mutant hSDF-154, which binds to and induces internalization of CXCR4 without activating CXCR4-related signaling and cell migration, may serve as an optimal CXCR4 antagonist.
17038674 The SDF-1/CXCR4 axis plays a critical role in regulating initial vessel formation, and may function as a morphogen during human embryonic vascular development.
17038526 under shear stress, T cells encountering apically presented CXCL12 were primed to undergo robust LFA-1-dependent transendothelial migration toward subendothelial CCL5
17034033 SDF-1 transiently regulates the number and affinity of alpha(v)beta(3) receptors by prostate cancer cells to enhance their metastatic behavior by increasing adhesiveness and invasiveness.
17015707 comparison of DOCK2 and Vav1 involvement in CXCL12-promoted Rac activation and alpha4beta1-dependent human T cell adhesion indicated a more prominent role of Vav1 than DOCK2
16990599 Tax expression correlated with activation of the SDF-1/CXCR4 axis
16977794 SDF-1-CXCR4 axis contribute to invasiveness of Human Cervical Carcinoma cells.
16964435 Observational study of gene-disease association. (HuGE Navigator)
16964435 Rsults support the hypothesis that the mutation of allele SDF1-3'A could have a possible late-stage protective effect on HIV-1 disease progression in the Brazilian population.
16960937 Patients with RA had a significantly and constantly increased p-CXCL12 level compared to controls.
16948905 SDF-1 and CXCR4 play an important role in gestation and they are also important in maternofetal immune tolerance during pregnancy.
16948134 Microvascular endothelial cellsfrom patients with systemic sclerosisexpressed significantly higher amounts of both isoforms of SDF-1 in the early stage of disease.
16943240 In this review, we consider the pathological nature and characteristics of the CXCL12/CXCR4 pathway in the tumor microenvironment. Strategies for therapeutically targeting the CXCL12/CXCR4 axis also are discussed.
16929176 Preferential role of in cytotoxic T lymphocyte migration toward melanoma cells.
16923552 SDF-1 G > A polymorphism at position 801 plays no role in multiple myeloma but may have a role in progression of chronic lymphocytic leukemia
16905744 Induces tyrosine phosphorylation of cortactin, leading to extracellular signal-regulated kinase activation and chemotaxis.
16875673 existence of an additional receptor(different from CXCR4) through which CXCL12 exerts its biological effects in endothelial cells
16865553 Observational study of gene-disease association. (HuGE Navigator)
16857992 low levels of SDF-1alpha in breast cancer cells regulate interactions between BM stroma and hematopoietic progenitors, consequently facilitating normal hematopoiesis.
16823956 SDF-1alpha has an important role in CD34+/CXCR4+ progenitor cell mobilization after cardiac surgery.
16823836 Adenosine increases cell-surface CXCR4 protein, which enables the carcinoma cells to migrate toward CXCL12.
16818471 Observational study of gene-disease association. (HuGE Navigator)
16818471 Gene is associated with acute myeloid leukemia and with the risk of distant tissue infiltration by tumor cells.
16782208 Our findings suggest that increased CXCL12 may initiate and augment the inflammatory response during MS.
16779827 there is a significant elevation of SDF-1 expression in the subacromial bursa of patients with rotator cuff disease
16756955 we hypothesized that the tumor environment in the lymph nodes may cause the reduction of CXCR4 levels in the metastatic tumor cells because of: (1) high SDF-1 levels and (2) lower levels of HIF-1alpha.
16703398 CXCL12, the c-myc-regulated gene is involved in genotype-C-HBV-related HCC, suggesting that c-myc is related to the hepatocarcinogenic activity of genotype-C HBV.
16648972 Since we demonstrated that not only SDF-1, but also HGF and LIF are upregulated in damaged tissues, we postulate that CXCR4+ c-Met+ LIF-R+ TCSC could be mobilized from the BM into the PB, where they play a role in tissue repair/regeneration.
16611258 Observational study of gene-disease association. (HuGE Navigator)
16611258 SDF1-3'A allele may not be sufficient to prevent the risk of HIV-1 infection and may be unrelated to the progression of HIV-1 infection in the Brazilian population.
16529059 Observational study of gene-disease association. (HuGE Navigator)
16507142 Attachment of CXCL12 to heparan sulfate proteoglycans is upregulated by inflammatory cytokines. Upregulation of chemokine during chronic inflammation and HSPG-dependent immobilization of CXCL12 in endothelial cells have therapeutic potential.
16503409 results implicate CD45, Cbl, Cbl-b, src kinases and potentially other associated proteins as mediators of SDF-1alpha/CXCL12-induced cell migration of Jurkat T cells
16494621 The SDF-1/CXCR4 axis promotes hematopoietic stem/progenitor cell proliferation in contact with mesenchymal stem cells. SDF-1 stimulates retention of HSPC in MSC niches which expose them to stimulatory and inhibitory factors in a paracrine manner.
16489019 Results strongly suggest that the CXCR4/CXC12 axis plays an important role in the development of peritoneal carcinomatosis from gastric carcinoma.
16485782 Observational study of gene-disease association. (HuGE Navigator)
16480760 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
16343773 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
16306115 SDF1-3'A polymorphism plays a role in thrombotic risk in chronic myeloproliferative diseas
16286055 Observational study of genotype prevalence. (HuGE Navigator)
16286054 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16284526 Observational study of gene-disease association. (HuGE Navigator)
16284526 The SDF1-3'A SNP (single nucleotide polymorphism) was associated with an increased risk for HIV-1 infection (P = 0.0319).
16261210 Observational study of gene-disease association. (HuGE Navigator)
16249700 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16227796 Observational study of gene-disease association. (HuGE Navigator)
16206074 Observational study of gene-disease association. (HuGE Navigator)
16188969 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
16177829 Observational study of gene-disease association. (HuGE Navigator)
16177829 Haplotype analysis of SDF-1 in a longitudinal HIV-1/AIDS cohort study found significant associations for two single nucleotide polymorphisms and one haplotype in African Americans.
16159864 IGF-I may act to limit atrophy and apoptosis during reverse remodeling and to promote repair and regeneration in concert with stromal cell derived factor.
16148115 C3a increased the binding affinity of CXCL12 to human CXCR4(+)/C3aR(-), REH pro-B cells, which is compatible with a direct interaction between C3a and CXCL12
16123688 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16114056 CXCL12/CXCR4 axis is expressed in prostate cancer bone metastasis and exogenous CXCL12 induced MMP-9 expression.
16112086 SDF-1-alpha increases endothelial proliferation and migration involving the activation of BK(Ca) and an increased production of NO.
16107333 RDC1, which we propose to rename as CXCR7, is a receptor for CXCL12
16033774 Over expression of stromal cell derived factor-1 promotes glioma invasiveness through membrane type-2-matrix metalloproteinase
15998835 RGS16 is a negative regulator of SDF-1-CXCR4 signaling in megakaryocytes
15987445 SDF-1 can increase the invasiveness and migration of breast cancer cells; its levels correlated with node involvement and long-term survival in patients with breast cancer
15980693 Observational study of gene-disease association. (HuGE Navigator)
15978329 Observational study of gene-disease association. (HuGE Navigator)
15978329 AA and AG genotypes of SDF-1 may be considered as factors increasing the susceptibility of Iranian women to breast cancer
15972662 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
15972632 first-trimester trophoblast cells produce CXCL12, which in turn chemoattracts decidual CD56(bright)CD16(-) NK cells
15965952 Data suggest that CXCL12 and CXCL13 may directly modulate cellular proliferation and collagen type I in osteoarthritis patients.
15955592 Observational study of gene-disease association. (HuGE Navigator)
15955592 AA and AG genotypes of SDF-1 may have a role in the susceptibility of Iranian patients to lung cancer
15921680 These results suggest a possible important "cross-talk" between SDF-1/CXCR4 and EGFR intracellular pathways that may link signals of cell proliferation in ovarian cancer.
15917309 co-overexpression of coactivators and her2/neu with poor prognosis: coactivators increase SDF-1alpha expression whereas her2/neu stabilize CXCR4 protein in breast cancer.
15888687 analysis of the role of the SDF-1-CXCR4 axis in trafficking of normal stem cells and metastasis of cancer stem cells
15882617 Findings indicate that fibroblasts within invasive breast carcinomas contribute to tumor promotion in large part through the secretion of SDF-1.
15872091 activation of Vav1-Rac signaling pathway by CXCL12 represents an important inside-out event controlling efficient up-regulation of alpha4beta1-dependent T lymphocyte adhesion
15857508 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
15844659 prostate cancers may be influenced by the CXCL12:CXCR4 pathway during metastasis
15843590 In an organotypic melanoma culture model, cytotoxic T cells (CTL) mediated by CXCL12 secreted by the melanoma cells migrate from the top layer through the collagen/fibroblast separating layer toward the tumor cells, resulting in tumor cell apoptosis.
15840658 JUN-dependent expression of PTN and SDF-1 in fibroblasts has a role in keratinocyte proliferation
15831676 Akt activation, but not ERK1/2 activation, is required for SDF-1alpha-induced migration of epitheloid carcinoma cells
15819887 CXCL12 directly binds to syndecan-4 in a glycosaminoglycan-dependent manner
15809737 SDF-1 related to invasion, migration, and growth of breast cancer cells; breast cancer cells equiped with CSF-1 autocrine circuit display more aggressive phenotype and greater growth ability
15808852 Data demonstrate that specific stimuli mediate stromal-cell derived factor 1 production through promoter activation in a cell-specific manner.
15805285 CHK down-regulates CXCR4 through the YY1 transcription factor, leading to decreased CXCR4/CXCL12-mediated breast cancer cell motility and migration.
15793201 Genotype influences insulin-dependent mobilization of adult progenitor cells in type 2 diabetes.
15754978 Observational study of genotype prevalence. (HuGE Navigator)
15754978 Frequency distribution of SDF1-3'A mutations in Brazilian Amazon region
15753365 Elevated serum levels of stromal-derived factor-1alpha are associated with increased osteoclast activity and osteolytic bone disease in multiple myeloma patients
15748209 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
15728464 CXCL12-induced focal adhesion kinase activation and its recruitment to lipid rafts in progenitor B cells are critical parameters of CXCL12-induced chemotactic and adhesive responses in lipid rafts.
15718416 perturbation of SDF-1 during B-cell recovery retards neutrophil egress from the bone marrow; findings illustrate the dual role of SDF-1 in human B-cell and granulocyte homeostasis
15718415 carboxypeptidase N regulates the biologic activity of SDF-1alpha by reducing the chemokine-specific activity
15710459 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
15707999 These results demonstrate that Syk participates in CXCL12-induced cell polarization, which occurs in concert with cell adhesion mediated by beta1 integrin.
15701832 Increased SDF1 expression is associted with osteosarcoma tumor progression
15699497 Observational study of gene-disease association. (HuGE Navigator)
15699497 SDF1 gene variant is present in patients with type 1 diabetes mellitus and autoimmune thyroid disease.
15681827 decreased circulating CD26 levels in arthritis may influence CD26-mediated regulation of the chemotactic SDF-1/CXCR4 axis
15677562 SDF-1, may play a role in the maintenance, survival, and osteogenic capacity of immature bone marrow stromal stem cell populations
15641073 Our data support participation of SDF-1 in pathogenesis of rheumatoid arthritis and in progression of joint destruction.
15639953 Observational study of genotype prevalence. (HuGE Navigator)
15630457 SDF-1 triggered protein kinase C, zeta phosphorylation, translocation to the plasma membrane, and kinase activity
15630447 SDF-1 plays a major role in proliferative retinopathy and may be an ideal target for the prevention of proliferative retino
15611059 CXCL12 signaling is independent of Jak2 and Jak3
15608062 stromal cell-derived factor 1alpha/CXC chemokine receptor 4 pathway has roles in migration of neural stem cells to sites of CNS injury
15588513 SDF-1/CXCL12 enhanced cell survival in synergy with other cytokines involves activation of CREB and induction of Mcl-1 and c-Fos
15585097 potent activator of MAP kinases akt-dependent pathways in neuronal and non-neuronal cells
15575507 Observational study of genotype prevalence. (HuGE Navigator)
15548717 Bone marrow strongly expresses functional stromal-derived factor (CXCL12), the ligand for CXCR4
15536181 SDF1a has a role in migration of hematopoietic stem cells
15533859 Stromal cell-derived factor-1 is an important factor influencing the mobilization of early tissue-committed cells expressing cardiac, muscle, and endothelial markers in myocardial infarction.
15504551 HGF maintains the hematopoietic microenvironment through stimulating proliferation and adhesion to the extracellular matrix and promoting hematopoiesis through inducing constitutive production of IL-11, SDF-1 alpha, and SCF by stromal cells themselves
15475370 SDF-1 acts through ERK1/2 signalling pathway as a trophoblast survival factor.
15467730 Mechanisms of CXCR4/CXCL12-mediated prostate cancer cell migration and invasion.
15454484 CXCR4/CXCL12 axis may participate in the EBV-associated lymphomagenesis process in immunodeficient hosts.
15381727 T lymphocyte transendothelial migration was inhibited by treatment of HUVEC with purified neutrophil elastase, which selectively cleaved the amino terminus of HUVEC-bound SDF-1alpha.
15358596 CXCL12 signaling via CXCR4 directs intestinal epithelial cell migration, barrier maturation, and restitution, consistent with an important mechanistic role for these molecules in mucosal barrier integrity and innate host defense.
15345598 Dok-1 plays an important role in SDF-1alpha/CXCL12-induced chemotaxis in T cells.
15328206 Incubation with single chain Fv antibodies results in reduction of CXCL12-induced calcium mobilization in prostate cancer cells.
15319853 Observational study of gene-disease association. (HuGE Navigator)
15302103 Observational study of gene-disease association. (HuGE Navigator)
15292258 A mutant SDF-1 that does not interact with heparan sulsfate is readily cleaved by dipeptidyl peptidase IV.
15286810 Circulating fibrocytes traffic to the lungs in response to CXCL12 and mediate fibrosis.
15240098 These findings suggest that the interaction between SDF-1 and CXCR4 ligand-receptor system is involved in the process of PC metastasis by the activation of cancer cell migration.
15236615 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15235108 SDF-1alpha and its receptor chemokine receptor CXCR4 induced transendothelial breast cancer cell migration through activation of the PI-3K/AKT pathway and Ca(2+)-mediated signaling.
15223017 study indicates that lymphoma patients from Brazil are more likely to carry the 3'A gene than patients with lymphoid leukemias, suggesting that this polymorphism may be a differential determinant of lymphomas and lymphoid leukemia.
15192272 Observational study of gene-disease association. (HuGE Navigator)
15192272 study provides the first evidence for SDF-3'A polymorphism in resistance to HIV-1 infection in Thais
15166527 Observational study of gene-disease association. (HuGE Navigator)
15146553 CD26/DPPIV is likely to directly modulate various SDF-1alpha induced functions
15140377 Observational study of genotype prevalence. (HuGE Navigator)
15113900 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
15076247 Observational study of genotype prevalence. (HuGE Navigator)
15048928 this study suggested that stromal cell-derived factor 1 can influence neural progenitor cells function through CXCR4 and that CXCR4 is functional on neural progenitor cells
15033938 syndecan-4/CXCR4 complex is likely a functional unit involved in SDF-1 binding
15026312 the altered leukocyte response to CXCL12 may account for the pathologic retention of mature polymorphonuclear cells in the bone marrow (myelokathexis) and for an altered lymphocyte trafficking in WHIM syndrome
15021309 Observational study of gene-disease association. (HuGE Navigator)
14995074 the endogenous CXCL12/CXC-chemokine receptor 4 signaling axis is critical for neuroblastoma cell survival and proliferation
14973260 first-trimester trophoblast cells express functional CXCR4/CXCL12, which may play an important role in early pregnancy such as stimulating trophoblast cell proliferation or differentiation in an autocrine manner
14871974 CCL19 and CXCL12 have roles in chemotaxis of mantle cell lymphoma B cells
14764445 Important mechanistic role for CXCR4 and SDF-1/CXCL12 in regulating angiogenesis within the human intestinal mucosa.
14757413 early tissue-specific stem cells reside in normal human and murine bone marrow, express the CXCR4 receptor on their surface and can be highly enriched (in humans and mice) after chemotaxis to SDF-1 gradient
14688392 We observed a statistically significant decrease in the levels of SDF-1 on myeloma cells in four consecutive apheresis collections compared with premobilization bone marrow specimens.
14684377 SDF-1/CXCL12 inhibited cAMP production in response to adenylyl cyclase activator forskolin; inhibition abrogated by anti-CXCR4 antibody or receptor desensitization. Inhibited forskolin-induced ion transport in voltage-clamped polarized T84 cells.
14679085 Observational study of gene-disease association. (HuGE Navigator)
14630801 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
14624371 Observational study of gene-disease association. (HuGE Navigator)
14623290 In the present study we report that two toxins from Clostridium species which inhibit the small GTPase Rho suppressed SDF-1alpha-induced generation of intracellular calcium transients in HPC.
14600836 both at molecular and protein levels CXCL10 and CXCL12 significantly increased only when cells were differentiated on calcium phosphate-coated slides
14555820 BMECs produce and release small amounts of SDF-1 and express CXCR4 in vivo only
14525775 The differential processing of SDF-1alpha and SDF-1beta provides biologic significance to the existence of 2 splice forms of the chemokine.
13130466 the SDF-1/CXCR4 ligand/receptor pair is likely to play an important functional role in T lymphocyte accumulation and positioning within the rheumatoid synovium.
12960279 Serum modification and inactivation contribute to the failure of SDF-1 to block HIV-1 infection and spread in man.
12953097 Inducible CXCR3 ligands control plasmacytoid dendritic cell responsiveness to this constitutive chemokine.
12949249 CXCL12 displays antimicrobial activity against E. coli and S. aureus.
12907452 By triggering specific adhesion of circulating KSHV-infected cells and favoring their entry into the extravascular cutaneous space, endothelial cell-associated SDF-1 in cutaneous capillaries may dictate the preferential occurrence of KS in the skin.
12907449 Carboxyphosphorylated-ERM dephosphorylation begins within seconds of stimulation by chemokine SDF-1 alpha or secondary lymphoid tissue cytokine and ERM proteins lose their punctate distribution with kinetics paralleling the loss of microvilli.
12882655 results confirm a role for SDF-1alpha and IL-7 in HIV-1 disease progression, and suggest that these cytokines play a role in the modulation of CXCR4
12865405 HGF, SDF-1, and MMP-9 have roles in stress-induced human CD34+ stem cell recruitment to the liver
12860456 Observational study of gene-disease association. (HuGE Navigator)
12834106 Increased sdf1a expression in basal ganglia neurons of patients with advanced HIV CNS disease suggests it may also contribute to pathogenesis.
12834106 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
12817019 SDF-1alpha stimulates prolonged activation of extracellular signal-regulated kinases ERK1 and ERK2 in Jurkat T lymphocytes via a mechanism requiring Src homology 2 domain-containing leukocyte protein of 76 kDa (SLP-76) scaffold protein and ZAP-70 kinase.
12787886 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
12783869 role in regulating ERK activation in lymphocytes by phophatases
12783211 Factors other than alteration in SDF-1/CXCR4 chemokine system must account for marrow infiltration of neoplastic cells in B-cell chronic lymphocytic leukemia.
12775566 TGF-beta1-controlled reduction in SDF-1 expression influences bone marrow cell migration and adhesion, which could affect the motility of cells trafficking the bone marrow.
12769333 SDF-1 activated MMP-9 in bone marrow (BM) cells, causing release of soluble Kit-ligand and transfer of hematopoietic stem cells from a quiescent to a proliferative niche
12766157 SDF-1-dependent polarization of CXCR4 is promoted by leukocyte-endothelium interaction
12761880 examination of expression in prostate cancer
12750733 SDF-1 enhanced the expansion and differentiation of primitive cord blood cells in a manner that was dependent upon both the concentration of SDF-1 and the presence of specific cytokines
12730110 invading extravillous trophoblasts that eventually perform endovascular invasion express CXCL12, the ligand for CXCR4, but not ligands for CXCR3.
12705474 Sdf1 is expressed in myocardium and skeletal muscle.
12702590 Stromal cell-derived factor 1alpha stimulates human glioblastoma cell growth through the activation of both extracellular signal-regulated kinases 1/2 and Akt.
12692604 plasma stromal cell-derived factor-1 levels in normal healthy donors for allogeneic peripheral blood stem cell transplantation (PBSCT) and in patients for autologous PBSCT
12605695 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
12591904 In human bone marrow, CXCL12 triggers a sustained adhesion response specifically in progenitor (pro- and pre-) B cells.
12571520 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12557141 Observational study of gene-disease association. (HuGE Navigator)
12511407 results indicate that normal human hematopoietic stem and progenitor cells express functional C3aR and that the C3aR-C3a axis sensitizes the responses of these cells to SDF-1
12485835 expressed in human brain tumors and is involved in glial proliferation in vitro
12482395 SDF-1alpha plays an important regulatory role in the altered B-cell responses seen in HIV-1 infection.
12482395 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
12444109 migration of murine and human IFN-producing cells to CXCR3 ligands in vitro requires engagement of CXCR4 by CXCL12
12436194 Observational study of genotype prevalence. (HuGE Navigator)
12393663 Role of the intracellular domains of CXCR4 in SDF-1-mediated signaling
12370187 beta-arrestin2 can function not only as a regulator of CXCR4 signaling but also as a mediator of stromal cell-derived factor 1alpha-induced chemotaxis, via the ASK1/p38 MAPK pathway
12354773 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
12239174 signaling is active in rhabdomyosarcoma cells and regulates locomotion, chemotaxis, and adhesion
12239139 CCR5-binding chemokines modulate induced responses of progenitor B cells in human bone marrow through heterologous desensitization of the CXCR4 chemokine receptor.
12215924 Observational study of gene-disease association. (HuGE Navigator)
12201365 Observational study of gene-disease association. (HuGE Navigator)
12149427 The stimulating effect of GAGs was caused by the formation of a stable haptotactic SDF-1 gradient, as SDF-1 bound to immobilized GAGs and triggered HSC migration. Dimerization of presented SDF-1 or increased binding to CXCR4 are possible mechanisms.
12135674 Activation of Wiskott-Aldrich syndrome protein and its association with other proteins by stromal cell-derived factor-1alpha is associated with cell migration in Jurkat cells, a T-lymphocyte line.
12088413 SDF-1/CXCL12 upregulated T-cell activation, and a G-coupled protein mediated signaling pathway was necessary for stimulation of T cells by CXCL12.
12044982 SDF-1alpha may play a role in the neuronal response to HIV in the brains of AIDS patients.
12044982 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
12036857 Lck is required for stromal cell-derived factor 1 alpha (CXCL12)-induced lymphoid cell chemotaxis.
12036856 induced transient activation of ERK1/2, ribosomal S6 kinase (p90RSK) and Akt, molecules implicated in cell survival. SDF1A also acted synergistically with other cyotkines.
12034737 role in HIV-1 entry
12032878 Observational study of gene-disease association. (HuGE Navigator)
12004084 leukemic Philadelphia chromosome-positive (Ph+)CD34+ cells from newly diagnosed CML patients that express the chemokine receptor CXCR4 migrate in response to stromal-derived factor-1 (SDF-1)
12001056 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11994484 Up-regulation by SDF-1 alpha of lymphocyte adhesion mediated by integrin alpha 4 beta 7 could contribute to lymphocyte homing to mucosa-associated lymphoid tissues.
11988632 Observational study of genotype prevalence. (HuGE Navigator)
11964548 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11953881 CXCR4/CXCL12 expression and signalling in kidney cancer
11950063 Observational study of genotype prevalence. (HuGE Navigator)
11929756 Regulation of endothelial cell branching morphogenesis
11912162 Use of the stromal cell-derived factor-1/CXCR4 pathway in prostate cancer metastasis to bone.
11898620 The frequencies of SDF1 mutation associated with the development of clinical symptoms upon infection with human immunodeficiency virus type 1 (HIV-1) were determined in a cohort of individuals from Moscow
11884424 SDF1 is expressed in medullar epithelial cells forming Hassall's corpuscles and demonstrates a potential role in the elimination of apoptotic thymocytes in normal and HIV-1-infected thymic tissues.
11877260 B-cell chemotaxis responsiveness to SDF-1alpha is profoundly suppressed by surrogate antigen.
11870628 These findings support a pivotal role for HEC-expressed CXCL12 and its receptor on T cells in the regulation of T lymphocyte homing to lymph nodes.
11867624 elastase-mediated proteolysis of SDF-1/CXCR4 is part of a mechanism regulating their biological functions in both homeostatic and pathologic processes
11865429 the presence of the SDF-1 3'A gene correlates with accelerated disease progression in HIV-1-infected children born to seropositive mothers but does not protect against mother-to-child HIV-1 transmission
11860823 Observational study of genotype prevalence. (HuGE Navigator)
11860793 Observational study of genotype prevalence. (HuGE Navigator)
11830456 exerts an antiapoptotic effect on CD34(+) hematopoietic progenitor cells through an autocrine/paracrine regulatory loop
11729511 Observational study of genotype prevalence. (HuGE Navigator)
11709782 Observational study of gene-disease association. (HuGE Navigator)
11709782 Association of stromal cell-derived factor 1 genotype with disease progression of HIV infection
11694103 Meta-analysis of gene-disease association. (HuGE Navigator)
11693435 Observational study of gene-disease association. (HuGE Navigator)
11504955 Observational study of gene-disease association. (HuGE Navigator)
11389173 SDF1 is involved in astrocyte division and MAP kinase signal transduction.
11328308 Observational study of gene-disease association. (HuGE Navigator)
11287575 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
11162626 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
11027346 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
11023492 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
10872839 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
10820198 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
10772939 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
10600606 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
10582593 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
10486323 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
10430052 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
10196252 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
9826729 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
9744279 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
9653130 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
9601645 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha
8976200 HIV-1 gp120 from a T-cell-tropic virus causes CD4-dependent antagonism of CXCR4 response to SDF-1alpha, whereas gp120 from macrophage-tropic viruses causes CD4-dependent antagonism of CCR5 response to MIP-1alpha

AA Sequence

MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV      1 - 70
CIDPKLKWIQEYLEKALNKRFKM                                                    71 - 93
//

Text Mined References (1037)

PMID Year Title
27041792 2016 The Serum Concentrations of Chemokine CXCL12 and Its Specific Receptor CXCR4 in Patients with Esophageal Cancer.
26896000 2016 CXCR4-SDF-1 interaction potentially mediates trafficking of circulating tumor cells in primary breast cancer.
26851944 2016 Cancer-associated fibroblasts promote the progression of endometrial cancer via the SDF-1/CXCR4 axis.
26818832 2016 Expression of the CXCR4 ligand SDF-1/CXCL12 is prognostically important for adenocarcinoma and large cell carcinoma of the lung.
26806619 2016 Cell migration towards CXCL12 in leukemic cells compared to breast cancer cells.
26782945 2016 Overexpression of SDF-1 activates the NF-?B pathway to induce epithelial to mesenchymal transition and cancer stem cell-like phenotypes of breast cancer cells.
26782415 2015 Chemokine receptor CXCR4 and its ligand CXCL12 expressions and clinical significance in bladder cancer.
26782381 2015 CXCL12 G801A polymorphism and susceptibility to glioma: a case?control study.
26722521 2015 Prognostic significance of CXCL12, CXCR4, and CXCR7 in patients with breast cancer.
26722422 2015 Wnt/?-catenin pathway is required for epithelial to mesenchymal transition in CXCL12 over expressed breast cancer cells.
26721717 2016 CXCR4, CXCR7, and CXCL12 are associated with trophoblastic cells apoptosis and linked to pathophysiology of severe preeclampsia.
26718114 2016 Twist-1 Enhances Bone Marrow Mesenchymal Stromal Cell Support of Hematopoiesis by Modulating CXCL12 Expression.
26602164 2016 Blood fibrocytes are recruited during acute exacerbations of chronic obstructive pulmonary disease through a CXCR4-dependent pathway.
26560447 2015 Interstitial Fluid Flow Increases Hepatocellular Carcinoma Cell Invasion through CXCR4/CXCL12 and MEK/ERK Signaling.
26552750 2015 Chemotherapeutic agents attenuate CXCL12-mediated migration of colon cancer cells by selecting for CXCR4-negative cells and increasing peptidase CD26.
26538086 2015 Improving chemotherapeutic efficiency in acute myeloid leukemia treatments by chemically synthesized peptide interfering with CXCR4/CXCL12 axis.
26463123 2015 Molecular difference between WASP and N-WASP critical for chemotaxis of T-cells towards SDF-1?.
26441035 2016 Stromal cell-derived factor 1? (SDF-1?): A marker of disease burden in patients with atrial fibrillation.
26435001 2015 Bisphenol AF stimulates transcription and secretion of C-X-C chemokine ligand 12 to promote proliferation of cultured T47D breast cancer cells.
26414794 2016 CXCL12/CXCR4 activation by cancer-associated fibroblasts promotes integrin ?1 clustering and invasiveness in gastric cancer.
26413812 2015 JAK2 tyrosine kinase mediates integrin activation induced by CXCL12 in B-cell chronic lymphocytic leukemia.
26408542 2015 Sustained myocardial production of stromal cell-derived factor-1? was associated with left ventricular adverse remodeling in patients with myocardial infarction.
26406413 2015 Stromal cell derived factor-1 and CXCR4 expression in colorectal cancer promote liver metastasis.
26398122 2015 A CXCR4 antagonist leads to tumor suppression by activation of immune cells in a leukemia-induced microenvironment.
26374452 2016 Prognostic value of CXCL12 and CXCR4 in inoperable head and neck squamous cell carcinoma.
26349988 2015 miR-101 represses lung cancer by inhibiting interaction of fibroblasts and cancer cells by down-regulating CXCL12.
26338423 2015 EGFR-L858R mutant enhances lung adenocarcinoma cell invasive ability and promotes malignant pleural effusion formation through activation of the CXCL12-CXCR4 pathway.
26330165 2015 Pancreatic Cancer Cell Migration and Metastasis Is Regulated by Chemokine-Biased Agonism and Bioenergetic Signaling.
26324845 2015 Association of chemokine CXC ligand 12 gene polymorphism (rs1746048) with cardiovascular mortality in patients with rheumatoid arthritis: results from the Norfolk Arthritis Register.
26296527 2015 Dermal fibroblast expression of stromal cell-derived factor-1 (SDF-1) promotes epidermal keratinocyte proliferation in normal and diseased skin.
26277915 2015 CXCL12 and CXCR4 as predictive biomarkers of glioma recurrence pattern after total resection.
26235278 2015 Notch pathway promotes ovarian cancer growth and migration via CXCR4/SDF1? chemokine system.
26231656 2015 SDF-1alpha concentration dependent modulation of RhoA and Rac1 modifies breast cancer and stromal cells interaction.
26212341 2015 Decreased CXCL12 is associated with impaired alveolar epithelial cell migration and poor lung healing after lung resection.
26205534 2015 The diagnostic and prognostic value of serum CXCL12 levels in patients with ischemic stroke.
26191295 2015 CXCL12 rs266085 and TNF-? rs1799724 polymorphisms and susceptibility to cervical cancer in a Chinese population.
26188201 2015 Insights into the mechanism of CXCL12-mediated signaling in trophoblast functions and placental angiogenesis.
26168882 2015 A SDF1 genetic variant confers resistance to HIV-1 infection in intravenous drug users in China.
26166636 2015 CXCL12/CXCR4 signal involved in the regulation of trophoblasts on peripheral NK cells leading to Th2 bias at the maternal-fetal interface.
26133117 2015 Lack of an Association between the SDF-1 rs1801157 Polymorphism and Coronary Heart Disease: A Meta-Analysis.
26130416 2015 Chemokines and their receptors in esophageal cancer--the systematic review and future perspectives.
26103953 2015 miR-448 negatively regulates ovarian cancer cell growth and metastasis by targeting CXCL12.
26100385 2015 Serum CXCL12 levels are associated with stroke severity and lesion volumes in stroke patients.
26100110 2015 CXCL12-CXCR7 axis is important for tumor endothelial cell angiogenic property.
26096543 2015 Analysis of CCR5 and SDF-1 genetic variants and HIV infection in Indian population.
26082290 2015 Recruitment of mesenchymal stem cells by stromal cell-derived factor 1? in pulp cells from deciduous teeth.
26072067 2015 CXCL12 G801A polymorphism and cancer risk: An updated meta-analysis.
26058075 2015 CXCL12-Producing Vascular Endothelial Niches Control Acute T Cell Leukemia Maintenance.
26049754 2015 The critical and specific transcriptional regulator of the microenvironmental niche for hematopoietic stem and progenitor cells.
26044561 2015 Application of chemokine receptor antagonist with stents reduces local inflammation and suppresses cancer growth.
26026718 2015 SDF-1/CXCR4 promotes F5M2 osteosarcoma cell migration by activating the Wnt/?-catenin signaling pathway.
26008895 2015 Endomyocardial expression of SDF-1 predicts mortality in patients with suspected myocarditis.
25997540 2015 AMD3100 reduces CXCR4-mediated survival and metastasis of osteosarcoma by inhibiting JNK and Akt, but not p38 or Erk1/2, pathways in in vitro and mouse experiments.
25995033 2016 SDF-1 and CXCR4 in synovium are associated with disease activity and bone and joint destruction in patients with rheumatoid arthritis treated with golimumab.
25982843 2015 Beneficial effect of the CXCL12-3'A variant for patients undergoing hematopoietic stem cell transplantation from unrelated donors.
25976655 2015 Estrogen promotes the survival of human secretory phase endometrial stromal cells via CXCL12/CXCR4 up-regulation-mediated autophagy inhibition.
25966814 2015 Concise Review: CXCR4/CXCL12 Signaling in Immature Hematopoiesis--Lessons From Pharmacological and Genetic Models.
25957946 2015 Chemoattraction of bone marrow-derived stem cells towards human endometrial stromal cells is mediated by estradiol regulated CXCL12 and CXCR4 expression.
25955316 2015 The CXCR4/CXCR7/CXCL12 Axis Is Involved in a Secondary but Complex Control of Neuroblastoma Metastatic Cell Homing.
25920609 2015 Cancer-associated fibroblast-derived CXCL12 causes tumor progression in adenocarcinoma of the esophagogastric junction.
25897806 2015 Regulator of G protein signaling 1 suppresses CXCL12-mediated migration and AKT activation in RPMI 8226 human plasmacytoma cells and plasmablasts.
25896762 2015 MicroRNA-135b suppresses extravillous trophoblast-derived HTR-8/SVneo cell invasion by directly down regulating CXCL12 under low oxygen conditions.
25884570 2015 Androgen receptor and chemokine receptors 4 and 7 form a signaling axis to regulate CXCL12-dependent cellular motility.
25872129 2015 The chemokine receptors CXCR4/CXCR7 and their primary heterodimeric ligands CXCL12 and CXCL12/high mobility group box 1 in pancreatic cancer growth and development: finding flow.
25860928 2015 Recurrence of glioblastoma after radio-chemotherapy is associated with an angiogenic switch to the CXCL12-CXCR4 pathway.
25843954 2015 Hypoxia-inducible factor 1? (HIF-1?) and reactive oxygen species (ROS) mediates radiation-induced invasiveness through the SDF-1?/CXCR4 pathway in non-small cell lung carcinoma cells.
25839939 2015 Genetic association of IL-6, TNF-? and SDF-1 polymorphisms with serum cytokine levels in diabetic foot ulcer.
25839711 2015 Chemokines in the melanoma metastasis biomarkers portrait.
25820929 2015 Stromal cell-derived factor-1? prevents endothelial progenitor cells senescence and enhances re-endothelialization of injured arteries via human telomerase reverse transcriptase.
25815440 2015 Resveratrol suppresses vascular endothelial growth factor secretion via inhibition of CXC-chemokine receptor 4 expression in ARPE-19 cells.
25810367 2015 Developmental expression patterns of chemokines CXCL11, CXCL12 and their receptor CXCR7 in testes of common marmoset and human.
25809793 2015 CD133+ and Nestin+ Glioma Stem-Like Cells Reside Around CD31+ Arterioles in Niches that Express SDF-1?, CXCR4, Osteopontin and Cathepsin K.
25803672 2015 Variant rs1801157 in the 3'UTR of SDF-1ß does not explain variability of healthy-donor G-CSF responsiveness.
25797207 2015 CCR2-64I polymorphism is associated with Non-Small Cell Lung Cancer in Tunisian patients.
25753525 2015 Mild Heat Treatment Primes Human CD34(+) Cord Blood Cells for Migration Toward SDF-1? and Enhances Engraftment in an NSG Mouse Model.
25748833 2015 Matrix metalloproteinases regulate extracellular levels of SDF-1/CXCL12, IL-6 and VEGF in hydrogen peroxide-stimulated human periodontal ligament fibroblasts.
25744829 2015 [CXCL12? and CXCL12? stimulate the migration of cultured LX-2 hepatic stellate cells].
25689618 2015 Serum ENA78/CXCL5, SDF-1/CXCL12, and their combinations as potential biomarkers for prediction of the presence and distant metastasis of primary gastric cancer.
25672413 2015 Stromal cell-derived factor-1 G801A polymorphism and the risk factors for cervical cancer.
25660395 2015 Platelet surface expression of stromal cell-derived factor-1 receptors CXCR4 and CXCR7 is associated with clinical outcomes in patients with coronary artery disease.
25620615 2015 CXCL12 and ADAM23 hypermethylation are associated with advanced breast cancers.
25619477 2015 Significantly inhibitory effects of low molecular weight heparin (Fraxiparine) on the motility of lung cancer cells and its related mechanism.
25609203 2015 Paracrine SDF-1? signaling mediates the effects of PSCs on GEM chemoresistance through an IL-6 autocrine loop in pancreatic cancer cells.
25605248 2015 Stromal-derived factor-1?/CXCL12-CXCR4 chemotactic pathway promotes perineural invasion in pancreatic cancer.
25601176 2015 Increased VEGF and decreased SDF-1? in patients with silent brain infarction are associated with better prognosis after first-ever acute lacunar stroke.
25560580 2015 The MCP-1, CCL-5 and SDF-1 chemokines as pro-inflammatory markers in generalized anxiety disorder and personality disorders.
25557636 2015 CXCR4 and CXCL12 Expression in Rectal Tumors of Stage IV Patients Before and After Local Radiotherapy and Systemic Neoadjuvant Treatment.
25526031 2014 Multiple myeloma cells recruit tumor-supportive macrophages through the CXCR4/CXCL12 axis and promote their polarization toward the M2 phenotype.
25509878 [The effects of simulated microgravity on the pattern of gene expression in human bone marrow mesenchymal stem cells under osteogenic differentiation].
25504440 2015 Intrinsic TGF-?2-triggered SDF-1-CXCR4 signaling axis is crucial for drug resistance and a slow-cycling state in bone marrow-disseminated tumor cells.
25504108 2015 Downregulation of CXCR4 by SDF-KDEL in SBC-5 cells inhibits their migration in vitro and organ metastasis in vivo.
25482641 2014 Transgene expression study of CXCR4 active mutants. Potential prospects in up-modulation of homing and engraftment efficiency of hematopoietic stem/progenitor cells.
25474514 2015 CXCL12 and CXCR4, but not CXCR7, are primarily expressed by the stroma in head and neck squamous cell carcinoma.
25471741 2014 Blockade of CXCL12/CXCR4 signaling inhibits intrahepatic cholangiocarcinoma progression and metastasis via inactivation of canonical Wnt pathway.
25461737 2015 Plasma stromal cell-derived factor 1?/CXCL12 level predicts long-term adverse cardiovascular outcomes in patients with coronary artery disease.
25461253 2015 C-X-C motif chemokine 12 influences the development of extramedullary hematopoiesis in the spleens of myelofibrosis patients.
25460081 HPV16 E2 enhances the expression of NF-?B and STAT3 target genes and potentiates NF-?B activation by inflammatory mediators.
25450979 2015 CD138-negative myeloma cells regulate mechanical properties of bone marrow stromal cells through SDF-1/CXCR4/AKT signaling pathway.
25446160 2015 Neonatal sex and weight influence CD34(+) cell concentration in umbilical cord blood but not stromal cell-derived factor 1-3'A polymorphism.
25433721 2015 Perivascular microenvironment in primary central nervous system lymphomas: the role of chemokines and the endothelin B receptor.
25421212 2016 SDF-1/CXCR4 Axis Regulates Cell Cycle Progression and Epithelial-Mesenchymal Transition via Up-regulation of Survivin in Glioblastoma.
25407240 2014 Expression of stromal cell-derived factor 1 and CXCR7 ligand receptor system in pancreatic adenocarcinoma.
25400746 2014 CXCL12 chemokine expression suppresses human breast cancer growth and metastasis in vitro and in vivo.
25400739 2014 Expression of SNCG, MAP2, SDF-1 and CXCR4 in gastric adenocarcinoma and their clinical significance.
25393253 2014 Expression of multidrug resistance 1 gene in association with CXCL12 in chronic myelogenous leukaemia.
25388055 2015 Increase of circulating stromal cell-derived factor-1 in heart failure patients.
25359780 2014 CXCL12/CXCR4 signaling counteracts docetaxel-induced microtubule stabilization via p21-activated kinase 4-dependent activation of LIM domain kinase 1.
25359136 2015 SDF1?-induced interaction of the adapter proteins Nck and HS1 facilitates actin polymerization and migration in T cells.
25344664 2015 Recruitment of skeletal muscle progenitors to secondary sites: a role for CXCR4/SDF-1 signalling in skeletal muscle development.
25326893 2015 CXCR4 Signaling Induced Epithelial-Mesenchymal Transition by PI3K/AKT and ERK Pathways in Glioblastoma.
25313609 2014 CCR2, CX3CR1, RANTES and SDF1 genetic polymorphisms influence HIV infection in a Zimbabwean pediatric population.
25312253 2014 A designed peptide targeting CXCR4 displays anti-acute myelocytic leukemia activity in vitro and in vivo.
25310198 2014 Activation of STAT3 is involved in malignancy mediated by CXCL12-CXCR4 signaling in human breast cancer.
25305322 2014 Synaptic release of CCL5 storage vesicles triggers CXCR4 surface expression promoting CTL migration in response to CXCL12.
25297929 2015 A clinicopathological analysis of primary mucosal malignant melanoma.
25283599 2015 SDF-1? is a novel autocrine activator of platelets operating through its receptor CXCR4.
25268356 2014 The CXCL12 G801A polymorphism is associated with cancer risk: a meta-analysis.
25241658 2014 Upregulation of stromal cell-derived factor 1? expression is associated with the resistance to neoadjuvant chemoradiotherapy of locally advanced rectal cancer: angiogenic markers of neoadjuvant chemoradiation.
25237195 2014 Internal tandem duplication mutations in FLT3 gene augment chemotaxis to Cxcl12 protein by blocking the down-regulation of the Rho-associated kinase via the Cxcl12/Cxcr4 signaling axis.
25220301 2014 Prognostic value of stromal cell-derived factor 1 expression in patients with gastric cancer after surgical resection.
25199050 2014 CXCL12+ stromal cells as bone marrow niche for CD34+ hematopoietic cells and their association with disease progression in myelodysplastic syndromes.
25150783 2014 SDF-1/CXCR4 promotes epithelial-mesenchymal transition and progression of colorectal cancer by activation of the Wnt/?-catenin signaling pathway.
25150002 2014 Comparison of chemokines (CCL-5 and SDF-1), chemokine receptors (CCR-5 and CXCR-4) and IL-6 levels in patients with different severities of depression.
25121739 2014 CXCL12 induces connective tissue growth factor expression in human lung fibroblasts through the Rac1/ERK, JNK, and AP-1 pathways.
25118993 2015 Downregulated CXCL12 expression in mesenchymal stem cells associated with severe aplastic anemia in children.
25085362 2015 Adult mouse subventricular zones stimulate glioblastoma stem cells specific invasion through CXCL12/CXCR4 signaling.
25084358 2014 Chemokine receptor CXCR7 is a functional receptor for CXCL12 in brain endothelial cells.
25042571 2014 A pro-tumourigenic loop at the human prostate tumour interface orchestrated by oestrogen, CXCL12 and mast cell recruitment.
25041836 2014 Expression patterns of SDF1/CXCR4 in human invasive breast carcinoma and adjacent normal stroma: correlation with tumor clinicopathological parameters and patient survival.
25029540 2014 Stromal cell-derived factor 1 gene polymorphism is associated with susceptibility to adverse long-term allograft outcomes in non-diabetic kidney transplant recipients.
25025568 2014 A Blk-p190RhoGAP signaling module downstream of activated G?13 functionally opposes CXCL12-stimulated RhoA activation and cell invasion.
24982366 2014 Immunohistochemical evaluation of CXCL12-CXCR4 axis and VEGFR3 expression in primary urothelial cancer and its recurrence.
24970800 2014 Tumor-derived CXCL8 signaling augments stroma-derived CCL2-promoted proliferation and CXCL12-mediated invasion of PTEN-deficient prostate cancer cells.
24950177 2014 A single nucleotide polymorphism in the stromal cell-derived factor 1 gene is associated with coronary heart disease in Chinese patients.
24950016 2014 SDF-1 signaling: a promising target in rheumatic diseases.
24940843 2014 The hematopoietic chemokine CXCL12 promotes integration of human endothelial colony forming cell-derived cells into immature vessel networks.
24934367 2014 High expression levels of CXCL12 and CXCR4 predict recurrence of adamanti-nomatous craniopharyngiomas in children.
24929539 2014 Resistin-induced stromal cell-derived factor-1 expression through Toll-like receptor 4 and activation of p38 MAPK/ NF?B signaling pathway in gastric cancer cells.
24913264 2015 CXCR4/CXCR7 molecular involvement in neuronal and neural progenitor migration: focus in CNS repair.
24909174 2015 CXCL12-? in primary tumors drives breast cancer metastasis.
24906407 2014 COUP-TFI modifies CXCL12 and CXCR4 expression by activating EGF signaling and stimulates breast cancer cell migration.
24887021 2014 The diacylglycerol kinase ?/atypical PKC/?1 integrin pathway in SDF-1? mammary carcinoma invasiveness.
24877105 2014 Relationships of alpha-SMA-positive fibroblasts and SDF-1-positive tumor cells with neoangiogenesis in nasopharyngeal carcinoma.
24870556 2014 Breast cancer metastasis: demonstration that FOXP3 regulates CXCR4 expression and the response to CXCL12.
24853339 2014 The relevance of the chemokine receptor ACKR3/CXCR7 on CXCL12-mediated effects in cancers with a focus on virus-related cancers.
24839815 2014 Stromal cell derived factor-1 (CXCL12) chemokine gene variant in myeloid leukemias.
24834915 2014 Platelet expression of stromal cell-derived factor-1 is associated with the degree of valvular aortic stenosis.
24825098 2015 Relationship between SDF-1G801A polymorphism and its expression in Tunisian patients with colorectal cancer.
24819308 2014 SDF-1/CXCR7 axis enhances ovarian cancer cell invasion by MMP-9 expression through p38 MAPK pathway.
24810923 2014 CXCL12-CXCR4 axis promotes the natural selection of breast cancer cell metastasis.
24806942 2015 Breast carcinoma cells modulate the chemoattractive activity of human bone marrow-derived mesenchymal stromal cells by interfering with CXCL12.
24799056 2014 CXCL12-CXCR4 contributes to the implication of bone marrow in cancer metastasis.
24762228 2013 Stromal cell-derived factor-1 (SDF-1)/CXCR4 axis enhances cellular invasion in ovarian carcinoma cells via integrin ?1 and ?3 expressions.
24761914 2014 The G801A polymorphism in the CXCL12 gene and risk of breast carcinoma: evidence from a meta-analysis including 2,931 subjects.
24751515 2014 Stromal cell-derived factor-1-3'A polymorphism is associated with decreased risk of myocardial infarction and early endothelial disturbance.
24722947 2014 CXC chemokine ligand 12 (CXCL12) and its receptor CXCR4.
24718687 2014 Oversulfated chondroitin sulfate binds to chemokines and inhibits stromal cell-derived factor-1 mediated signaling in activated T cells.
24708339 2014 Identification and characterization of circulating variants of CXCL12 from human plasma: effects on chemotaxis and mobilization of hematopoietic stem and progenitor cells.
24704323 2014 Stromal derived factor 1?: a chemokine that delivers a two-pronged defence of the myocardium.
24687413 2014 The role of polymorphisms of genes CXCL12/CXCR4 and MIF in the risk development IBD the Polish population.
24658853 2014 The SDF-1/CXCR4 axis induces epithelial–mesenchymal transition in hepatocellular carcinoma.
24637920 2014 SDF-1/CXCR4 signaling preserves microvascular integrity and renal function in chronic kidney disease.
24614402 2014 Knock-down of CD44 regulates endothelial cell differentiation via NF?B-mediated chemokine production.
24600982 2014 CXC chemokines CXCL1, CXCL9, CXCL10 and CXCL12 are variably expressed in patients with sickle cell disease and carriers: are they predictive tools for disease complications?
24594697 2014 CXCL12 chemokine expression suppresses human pancreatic cancer growth and metastasis.
24586072 2014 The role of SRC1 and SRC2 in steroid-induced SDF1 expression in normal and ectopic endometrium.
24584347 2014 MicroRNA-23a mediates post-transcriptional regulation of CXCL12 in bone marrow stromal cells.
24574213 2014 Reciprocal activation of CD4+ T cells and synovial fibroblasts by stromal cell-derived factor 1 promotes RANKL expression and osteoclastogenesis in rheumatoid arthritis.
24561124 2014 CXCL12-induced upregulation of FOXM1 expression promotes human glioblastoma cell invasion.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24534089 2014 Role of the CXCL12-CXCR4 axis in the development of deep rectal endometriosis.
24516346 2014 Stromal cell-derived factor-1 and its receptor CXCR4 are upregulated expression in degenerated intervertebral discs.
24498095 2014 C-terminal engineering of CXCL12 and CCL5 chemokines: functional characterization by electrophysiological recordings.
24492963 2014 Miro-1 links mitochondria and microtubule Dynein motors to control lymphocyte migration and polarity.
24486245 2014 Estrogen receptor beta and CXCR4/CXCL12 expression: differences by sex and hormonal status in lung adenocarcinoma.
24480462 2014 Neutralising properties of peptides derived from CXCR4 extracellular loops towards CXCL12 binding and HIV-1 infection.
24465621 2014 SDF1-a facilitates Lin-/Sca1+ cell homing following murine experimental cerebral ischemia.
24450273 2014 CXCL12-CXCR7 signaling activates ERK and Akt pathways in human choriocarcinoma cells.
24430363 2014 Impact of chemokines CCR5?32, CXCL12G801A, and CXCR2C1208T on bladder cancer susceptibility in north Indian population.
24416254 2014 Stromal derived factor-1 (SDF-1) and its receptors CXCR4 and CXCR7 in endometrial cancer patients.
24407584 2014 Kisspeptin-10 inhibits stromal-derived factor 1-induced invasion of human endometrial cancer cells.
24381939 2013 Enhancing the migration ability of mesenchymal stromal cells by targeting the SDF-1/CXCR4 axis.
24372262 2013 Innovative cell therapy in the treatment of serious adverse events related to both chemo-radiotherapy protocol and acute myeloid leukemia syndrome: the infusion of mesenchymal stem cells post-treatment reduces hematopoietic toxicity and promotes hematopoietic reconstitution.
24361877 2014 Polymorphism of stromal cell-derived factor-1 selectively upregulates gene expression and is associated with increased susceptibility to coronary artery disease.
24354491 2014 Differential expressions of stromal cell-derived factor-1? and vascular endothelial growth factor in the placental bed of pregnancies complicated by preeclampsia.
24291546 2014 Differential expression of SDF-1 isoforms in bladder cancer.
24282276 2014 Blocking SDF-1?/CXCR4 downregulates PDGF-B and inhibits bone marrow-derived pericyte differentiation and tumor vascular expansion in Ewing tumors.
24277075 2014 CXCR7 participates in CXCL12-induced CD34+ cell cycling through ?-arrestin-dependent Akt activation.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24238971 2014 CXC receptor 4 and stromal cell-derived factor 1 in primary tumors and liver metastases of colorectal cancer.
24218400 2014 Plasma levels of stromal cell-derived factor-1 (CXCL12) and circulating endothelial progenitor cells in women with idiopathic heavy menstrual bleeding.
24184476 2013 The role of SDF-1-CXCR4/CXCR7 axis in biological behaviors of adipose tissue-derived mesenchymal stem cells in vitro.
24175834 2013 CXCL12-CXCR4 promotes proliferation and invasion of pancreatic cancer cells.
24174685 2013 CXC chemokine receptor 7 (CXCR7) affects the migration of GnRH neurons by regulating CXCL12 availability.
24157575 2013 Inhibition of CXCL12/CXCR4 autocrine/paracrine loop reduces viability of human glioblastoma stem-like cells affecting self-renewal activity.
24116850 2014 Endothelial expression of CXCR7 and the regulation of systemic CXCL12 levels.
24102302 2014 Expression of platelet-bound stromal-cell derived factor-1 (SDF-1) and number of CD34(+) progenitor cells in patients with congestive heart failure.
24097873 2013 Prognostic and predictive blood-based biomarkers in patients with advanced pancreatic cancer: results from CALGB80303 (Alliance).
24094005 2013 CD164 regulates the tumorigenesis of ovarian surface epithelial cells through the SDF-1?/CXCR4 axis.
24091662 2013 Opposing effects of high- and low-molecular weight hyaluronan on CXCL12-induced CXCR4 signaling depend on CD44.
24085800 2014 SDF-1/CXCR4 axis promotes directional migration of colorectal cancer cells through upregulation of integrin ?v?6.
24079738 2013 Human skin melanocyte migration towards stromal cell-derived factor-1? demonstrated by optical real-time cell mobility assay: modulation of their chemotactic ability by ?-melanocyte-stimulating hormone.
24038789 2014 Stromal cell derived factor-1? promotes C-Kit+ cardiac stem/progenitor cell quiescence through casein kinase 1? and GSK3?.
24033610 2014 The role of SDF-1 and CXCR4 on odontoblastic differentiation in human dental pulp cells.
24032722 2013 Association of CXCL12 and CXCR4 gene polymorphisms with the susceptibility and prognosis of renal cell carcinoma.
24025971 2014 CXCR4, but not CXCR7, discriminates metastatic behavior in non-small cell lung cancer cells.
24024928 2013 Platelet-derived CXCL12 (SDF-1?): basic mechanisms and clinical implications.
24024210 2013 The SDF-1?3'A genetic variation is correlated with susceptibility of asthma in Iranian patients.
24022841 2014 CXCL12 induces lung cancer cell migration by polarized mtDNA redistribution.
24021782 2013 Application of chemokine CXC motif ligand 12 as a novel diagnostic marker in preoperative fine-needle aspiration biopsy for papillary thyroid carcinoma.
24015267 2013 Chronic cadmium exposure stimulates SDF-1 expression in an ER? dependent manner.
24014104 2013 SDF-1 restores angiogenesis synergistically with VEGF upon LDL exposure despite CXCR4 internalization and degradation.
24009233 2013 Lymphocyte cytosolic protein 1 is a chronic lymphocytic leukemia membrane-associated antigen critical to niche homing.
23985752 2013 Chemokines mRNA expression in relation to the Macrophage Migration Inhibitory Factor (MIF) mRNA and Vascular Endothelial Growth Factor (VEGF) mRNA expression in the microenvironment of endometrial cancer tissue and normal endometrium: a pilot study.
23935395 2013 CXCL12/CXCR4 signal axis plays an important role in mediating bone morphogenetic protein 9-induced osteogenic differentiation of mesenchymal stem cells.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
23924922 2013 CD40 signal regulates CXCR4 mediating ovarian carcinoma cell migration: implications for extrapelvic metastastic factors.
23901140 2013 The chemokine CXCL12 generates costimulatory signals in T cells to enhance phosphorylation and clustering of the adaptor protein SLP-76.
23895705 2013 Study on the expression levels of CXCR4, CXCL12, CD44, and CD147 and their potential correlation with invasive behaviors of pituitary adenomas.
23880174 2013 Distribution of CCR5-Delta32, CCR5 promoter 59029 A/G, CCR2-64I and SDF1-3'A genetic polymorphisms in HIV-1 infected and uninfected patients in the west region of Cameroon.
23869217 2013 Cooperative roles of SDF-1? and EGF gradients on tumor cell migration revealed by a robust 3D microfluidic model.
23812037 2013 CXCL12 induces hepatic stellate cell contraction through a calcium-independent pathway.
23802178 2013 Sulfopeptide probes of the CXCR4/CXCL12 interface reveal oligomer-specific contacts and chemokine allostery.
23734232 2013 Hierarchical organization of multi-site phosphorylation at the CXCR4 C terminus.
23712777 2013 SDF-1? upregulation of MMP-2 is mediated by p38 MAPK signaling in pancreatic cancer cell lines.
23711392 2013 The CXCL12-3'A allele plays a favourable role in patients with multiple myeloma.
23710557 Expression of SDF-1/CXCR4 axis in bone marrow mesenchymal stem cells derived from rheumatoid arthritis-usual interstitial pneumonia.
23702796 2013 Structural basis of the interactions between CXCR4 and CXCL12/SDF-1 revealed by theoretical approaches.
23701640 2014 HGF and SDF-1-mediated mobilization of CD133+ BMSC for hepatic regeneration following extensive liver resection.
23669361 2013 CXCL14 is a natural inhibitor of the CXCL12-CXCR4 signaling axis.
23666823 2013 Genetic variants on chromosome 10q11.21 are associated with ischemic stroke in the northern Chinese Han population.
23653000 2013 CXCL12 and TP53 genetic polymorphisms as markers of susceptibility in a Brazilian children population with acute lymphoblastic leukemia (ALL).
23645563 2013 Expression of the chemokines CXCL12 and CX3CL1 and their receptors in human nerve sheath tumors.
23637121 2013 Targeting the CD20 and CXCR4 pathways in non-hodgkin lymphoma with rituximab and high-affinity CXCR4 antagonist BKT140.
23623275 2013 CXCR4 transfection of cord blood mesenchymal stromal cells with the use of cationic liposome enhances their migration toward stromal cell-derived factor-1.
23620790 2013 CBAP functions as a novel component in chemokine-induced ZAP70-mediated T-cell adhesion and migration.
23619587 2013 Up-regulated expression of CXCL12 in human spleens with extramedullary haematopoiesis.
23615182 2013 Association of chemokine gene variants with end stage renal disease in North Indian population.
23602049 2013 The role of inflammatory chemokines in lymphoid neoorganogenesis in breast cancer.
23599431 2013 Induction of C-X-C chemokine receptor type 7 (CXCR7) switches stromal cell-derived factor-1 (SDF-1) signaling and phagocytic activity in macrophages linked to atherosclerosis.
23591873 2013 Association between G?i2 and ELMO1/Dock180 connects chemokine signalling with Rac activation and metastasis.
23588307 2013 Hematopoietic stem and progenitor cell mobilization in mice and humans by a first-in-class mirror-image oligonucleotide inhibitor of CXCL12.
23586735 2013 Potential for cardiac protection with dipeptidyl peptidase-4 inhibitors: the stromal cell-derived factor-1? hypothesis.
23571274 2013 Regulation of circulating neutrophil numbers under homeostasis and in disease.
23563306 2013 SDF-1-CXCR4 axis: cell trafficking in the cancer stem cell niche of head and neck squamous cell carcinoma.
23544621 2013 Low-level shear stress induces human mesenchymal stem cell migration through the SDF-1/CXCR4 axis via MAPK signaling pathways.
23543442 2013 Chemokines fluctuate in the progression of primary breast cancer.
23538388 2013 Inhibition of CXCR4-CXCL12 chemotaxis in melanoma by AMD11070.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23531450 2013 Relationship between chemokine (C-X-C motif) ligand 12 gene variant (rs1746048) and coronary heart disease: case-control study and meta-analysis.
23526079 2013 CXCR4-mediated Stat3 activation is essential for CXCL12-induced cell invasion in bladder cancer.
23502337 2013 Differential expression of CXCL1, CXCL9, CXCL10 and CXCL12 chemokines in alopecia areata.
23499762 2013 HGF and IGF-1 synergize with SDF-1? in promoting migration of myeloma cells by cooperative activation of p21-activated kinase.
23495012 2013 The chemokine CXCL12 and its receptor CXCR4 are implicated in human seminoma metastasis.
23473997 2013 Endogenous stromal cell-derived factor-1 (CXCL12) supports autonomous growth of acute myeloid leukemia cells.
23468253 2013 Focus on the role of the CXCL12/CXCR4 chemokine axis in head and neck squamous cell carcinoma.
23454481 2013 Current status of chemokines in the adult CNS.
23434321 2013 CXCR4/CXCL12 mediate autocrine cell- cycle progression in NF1-associated malignant peripheral nerve sheath tumors.
23395387 2013 Differences are evident within the CXCR4-CXCL12 axis between ethnically divergent South African populations.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23344887 2013 The CXCL12/CXCR4/CXCR7 ligand-receptor system regulates neuro-glio-vascular interactions and vessel growth during human brain development.
23335032 2013 The SDF-1 3'A genetic variation is correlated with elevated intra-tumor tissue and circulating concentration of CXCL12 in glial tumors: a study on Iranian anaplastic astrocytoma and glioblastoma multiforme patients.
23325742 2013 Impact of CCR2 and SDF1 polymorphisms on disease progression in HIV-infected subjects in Thailand.
23279723 2013 An infernal trio: the chemokine CXCL12 and its receptors CXCR4 and CXCR7 in tumor biology.
23259294 2012 [The expression and significance of SDF-1/CXCR4 biological axis in laryngeal squamous cell carcinoma and lymph node metastasize].
23258739 2013 Effects of stromal cell-derived factor-1 and survivin gene polymorphisms on gastric cancer risk.
23249958 2013 Genomic correlates of variability in immune response to an oral cholera vaccine.
23246486 2013 Prostaglandin E2 induces stromal cell-derived factor-1 expression in prostate stromal cells by activating protein kinase A and transcription factor Sp1.
23242967 2013 SDF-1alpha G801A polymorphism in Southern Iranian patients with colorectal and gastric cancers.
23212062 2012 Genome-wide association study of clinical dimensions of schizophrenia: polygenic effect on disorganized symptoms.
23207101 2013 HMGB1 and leukocyte migration during trauma and sterile inflammation.
23193972 2013 The concentration of human follicular fluid stromal cell-derived factor-1 is correlated with luteinization in follicles.
23192056 2012 Association of stromal-derived factor-1 alpha and endogenous sex hormones in men aged over 50 years with stable coronary artery disease.
23149815 2012 Stromal cell-derived factor-1? as a novel biomarker for hyperlipidemia.
23148226 2013 Heparin oligosaccharides inhibit chemokine (CXC motif) ligand 12 (CXCL12) cardioprotection by binding orthogonal to the dimerization interface, promoting oligomerization, and competing with the chemokine (CXC motif) receptor 4 (CXCR4) N terminus.
23143873 2012 Proteolytic processing of SDF-1? by matrix metalloproteinase-2 impairs CXCR4 signaling and reduces neural progenitor cell migration.
23133664 2012 Dasatinib inhibits CXCR4 signaling in chronic lymphocytic leukaemia cells and impairs migration towards CXCL12.
23129313 2013 The impact of the stromal cell-derived factor-1-3'A and E-selectin S128R polymorphisms on breast cancer.
23098564 2012 CXC chemokine ligand 12/stromal cell-derived factor-1 regulates cell adhesion in human colon cancer cells by induction of intercellular adhesion molecule-1.
23078136 2013 Stromal-derived factor-1 gene variations in pediatric patients with primary immune thrombocytopenia.
23070788 2012 Expression of stromal cell-derived factor 1 and CXCR7 in papillary thyroid carcinoma.
23053994 2012 Association between SDF1-3'A or CXCR4 gene polymorphisms with predisposition to and clinicopathological characteristics of prostate cancer with or without metastases.
23042661 2012 Plasma CXCL12 levels as a predictor of future stroke.
23039915 2012 High expression of CXCR4, CXCR7 and SDF-1 predicts poor survival in renal cell carcinoma.
23023114 2012 Stromal cell-derived factor-1? and macrophage migration-inhibitory factor induce metastatic behavior in CXCR4-expressing colon cancer cells.
22995914 2012 CXCL12/CXCR4 protein signaling axis induces sonic hedgehog expression in pancreatic cancer cells via extracellular regulated kinase- and Akt kinase-mediated activation of nuclear factor ?B: implications for bidirectional tumor-stromal interactions.
22987307 2012 CXCL12 enhances human neural progenitor cell survival through a CXCR7- and CXCR4-mediated endocytotic signaling pathway.
22978759 2013 CXCR7 mediates SDF1-induced melanocyte migration.
22975476 2012 Evaluation of circulating concentrations of CXCL1 (Gro-?), CXCL10 (IP-10) and CXCL12 (SDF-1) in ALL patients prior and post bone marrow transplantation.
22962615 2012 The role of genetic variants of Stromal cell-Derived Factor 1 in pediatric HIV-1 infection and disease progression.
22954782 2012 G801A polymorphism of human stromal cell-derived factor 1 gene raises no susceptibility to neoplastic lesions of uterine cervix.
22952422 2012 Stromal cell-derived factor 1? mediates resistance to mTOR-directed therapy in pancreatic cancer.
22939870 2012 The CXCL12 G801A polymorphism and cancer risk: evidence from 17 case-control studies.
22932666 2012 The CXCL12-CXCR4 chemokine pathway: a novel axis regulates lymphangiogenesis.
22916293 2012 Involvement of the CXCR7/CXCR4/CXCL12 axis in the malignant progression of human neuroblastoma.
22905867 2012 Thrombin induces de novo protein synthesis of stromal cell-derived factor-1? but not angiostatin in human platelets.
22885527 2012 The CXCL12/CXCR4 axis is involved in the maintenance of Th2 bias at the maternal/fetal interface in early human pregnancy.
22848341 2012 CXCL12/CXCR4 axis triggers the activation of EGF receptor and ERK signaling pathway in CsA-induced proliferation of human trophoblast cells.
22846168 2012 CD26 protease inhibition improves functional response of unfractionated cord blood, bone marrow, and mobilized peripheral blood cells to CXCL12/SDF-1.
22842611 2013 CXCL12 is a costimulator for CD4+ T cell activation and proliferation in chronic lymphocytic leukemia patients.
22784557 2012 Chemokine CXCL12 in neurodegenerative diseases: an SOS signal for stem cell-based repair.
22779681 2012 Critical role in CXCR4 signaling and internalization of the polypeptide main chain in the amino terminus of SDF-1? probed by novel N-methylated synthetically and modularly modified chemokine analogues.
22767589 2012 New insight into the SDF-1/CXCR4 axis in a breast carcinoma model: hypoxia-induced endothelial SDF-1 and tumor cell CXCR4 are required for tumor cell intravasation.
22762525 2012 CXCL12 G801A polymorphism contributes to cancer susceptibility: a meta-analysis.
22751460 2012 Association of CXCL12 levels in synovial fluid with the radiographic severity of knee osteoarthritis.
22738089 2012 Differential expression of CXC chemokines CXCL10 and CXCL12 in term and pre-term neonates and their mothers.
22736769 2012 Rapid uptake and degradation of CXCL12 depend on CXCR7 carboxyl-terminal serine/threonine residues.
22727731 2012 Role of the stromal-derived factor-1 (SDF-1)-CXCR4 axis in the interaction between hepatic stellate cells and cholangiocarcinoma.
22710983 2012 Distinctive contact between CD34+ hematopoietic progenitors and CXCL12+ CD271+ mesenchymal stromal cells in benign and myelodysplastic bone marrow.
22704519 2013 SDF-1/CXCL12 recruits B cells and antigen-presenting cells to the thymus of autoimmune myasthenia gravis patients.
22699677 2013 CXCL12, CXCR4 and IFN? genes expression: implications for proinflammatory microenvironment of breast cancer.
22690919 2012 Upregulation of stromal cell-derived factor by IL-17 and IL-18 via a phosphatidylinositol 3-kinase-dependent pathway.
22688512 2012 Regulation of cell migration by sphingomyelin synthases: sphingomyelin in lipid rafts decreases responsiveness to signaling by the CXCL12/CXCR4 pathway.
22683307 2013 A review on CXCR4/CXCL12 axis in oncology: no place to hide.
22675496 2012 CXCR3 antagonism of SDF-1(5-67) restores trabecular function and prevents retinal neurodegeneration in a rat model of ocular hypertension.
22670173 2012 CsA improves the trophoblasts invasiveness through strengthening the cross-talk of trophoblasts and decidual stromal cells mediated by CXCL12 and CD82 in early pregnancy.
22664794 2012 Angiotensin II enhances epithelial-to-mesenchymal transition through the interaction between activated hepatic stellate cells and the stromal cell-derived factor-1/CXCR4 axis in intrahepatic cholangiocarcinoma.
22613469 2012 Modeling SDF-1-induced mobilization in leukemia cell lines.
22581230 2012 Mutations in IRX5 impair craniofacial development and germ cell migration via SDF1.
22568557 2012 Altered regulation of CXCR4 expression during aging contributes to increased CXCL12-dependent chemotactic migration of CD4(+) T cells.
22554649 2012 The genetic variation of CCR5, CXCR4 and SDF-1 in three Chinese ethnic populations.
22553346 2012 Chemokine (C-X-C motif) ligand 12 is associated with gallbladder carcinoma progression and is a novel independent poor prognostic factor.
22549810 2013 Endocrine disrupting chemicals promote the growth of ovarian cancer cells via the ER-CXCL12-CXCR4 signaling axis.
22549778 2012 E-cadherin is critical for collective sheet migration and is regulated by the chemokine CXCL12 protein during restitution.
22535492 2012 Stromal factors SDF1?, sFRP1, and VEGFD induce dopaminergic neuron differentiation of human pluripotent stem cells.
22529914 2012 CXCL12 and [N33A]CXCL12 in 5637 and HeLa cells: regulating HER1 phosphorylation via calmodulin/calcineurin.
22526457 2012 CCL27-CCR10 and CXCL12-CXCR4 chemokine ligand-receptor mRNA expression ratio: new predictive factors of tumor progression in cutaneous malignant melanoma.
22513751 2012 Temporal profile of molecular signatures associated with circulating endothelial progenitor cells in human ischemic stroke.
22496601 2012 Expressions of CXCL12/CXCR4 in oral premalignant and malignant lesions.
22495096 2012 Cyclosporin A promotes crosstalk between human cytotrophoblast and decidual stromal cell through up-regulating CXCL12/CXCR4 interaction.
22492017 2012 Mesenchymal stem cell recruitment by stromal derived factor-1-delivery systems based on chitosan/poly(?-glutamic acid) polyelectrolyte complexes.
22490648 2012 [Correlations between chemokines CXCL12, CCL2, RANTES and early abortion].
22469823 2012 Differential effects of TGF-?1 and FGF-2 on SDF-1? expression in human periodontal ligament cells derived from deciduous teeth in vitro.
22457824 2012 Ubiquitination of CXCR7 controls receptor trafficking.
22450749 2012 SDF-1/CXCR4 signaling induces pancreatic cancer cell invasion and epithelial-mesenchymal transition in vitro through non-canonical activation of Hedgehog pathway.
22430135 CXCR4 and CXCL12 immunoreactivities differentiate primary non-small-cell lung cancer with or without brain metastases.
22427929 2012 CXCL12 mediates trophic interactions between endothelial and tumor cells in glioblastoma.
22415233 2012 The chemokine, CXCL12, is an independent predictor of poor survival in ovarian cancer.
22386691 2012 Lack of association between the CXCL12 rs501120 polymorphism and cardiovascular disease in Spanish patients with rheumatoid arthritis.
22370717 2012 HMGB1 promotes recruitment of inflammatory cells to damaged tissues by forming a complex with CXCL12 and signaling via CXCR4.
22362916 2013 Stromal cell-derived factor-1 overexpression induces gastric dysplasia through expansion of stromal myofibroblasts and epithelial progenitors.
22336440 2012 Serum levels of CXCL13 are associated with ultrasonographic synovitis and predict power Doppler persistence in early rheumatoid arthritis treated with non-biological disease-modifying anti-rheumatic drugs.
22333149 2011 [Expression of stromal cell derived factor-1/CXCR4 biology axis in myelodysplastic syndromes].
22311941 2012 Association of chemokine CXCL12-3'G801A polymorphism with systemic lupus erythematosus in a Han Chinese population.
22301555 2012 CXCL12-induced monocyte-endothelial interactions promote lymphocyte transmigration across an in vitro blood-brain barrier.
22270883 2012 CXCL12 signaling in the development of the nervous system.
22253872 2012 CXCR4/CXCL12 participate in extravasation of metastasizing breast cancer cells within the liver in a rat model.
22245379 2012 The CXCL12/CXCR4 axis promotes ligand-independent activation of the androgen receptor.
22232208 2012 The CXCR4/CXCR7/SDF-1 pathway contributes to the pathogenesis of Shiga toxin-associated hemolytic uremic syndrome in humans and mice.
22228277 2012 Increased stromal cell-derived factor-1 concentration levels in aqueous from patients with uveal melanoma.
22220905 2012 Deregulation of the CXCL12/CXCR4 axis in methotrexate chemotherapy-induced damage and recovery of the bone marrow microenvironment.
22220212 2011 Epigenetic changes of CXCR4 and its ligand CXCL12 as prognostic factors for sporadic breast cancer.
22200847 2012 Fibroblast growth factor 2 inhibits the expression of stromal cell-derived factor 1? in periodontal ligament cells derived from human permanent teeth in vitro.
22173290 2012 Strong expression of CXCL12 is associated with a favorable outcome in osteosarcoma.
22169299 2011 [Correlation of stromal cell derived factor-1 with angiogenesis and cell apoptosis in myelodysplastic syndromes].
22169298 2011 [Biological behavior of SDF-1/CXCR4 in patients with myelodysplastic syndrome].
22166550 2011 Association of the-801G/A polymorphism of CXCL12 gene with the risk of inflammatory bowel diseases development in a Polish population.
22142194 2012 Secreted CXCL12 (SDF-1) forms dimers under physiological conditions.
22128293 2012 Hypoxic stress simultaneously stimulates vascular endothelial growth factor via hypoxia-inducible factor-1? and inhibits stromal cell-derived factor-1 in human endometrial stromal cells.
22127289 2012 Chaotic particle swarm optimization for detecting SNP-SNP interactions for CXCL12-related genes in breast cancer prevention.
22125123 2012 The SDF-1 3'a genetic variation of the chemokine SDF-1? (CXCL12) in parallel with its increased circulating levels is associated with susceptibility to MS: a study on Iranian multiple sclerosis patients.
22114110 2012 Trophoblast-derived chemokine CXCL12 promotes CXCR4 expression and invasion of human first-trimester decidual stromal cells.
22095608 2011 Lack of association between RANTES-28, SDF-1 gene polymorphisms and systemic lupus erythematosus in the Malaysian population.
22092872 2012 Interleukin-4 and interleukin-13 prime migrational responses of haemopoietic progenitor cells to stromal cell-derived factor-1?.
22088972 2012 A role for the CXCL12 receptor, CXCR7, in the pathogenesis of human pulmonary vascular disease.
22077991 2012 Stromal cell-derived factor-1 (SDF-1/CXCL12) gene polymorphisms in pulmonary tuberculosis patients of south India.
22075627 2012 CXCR4/CXCL12 expression profile is associated with tumor microenvironment and clinical outcome of liver metastases of colorectal cancer.
22074556 2011 SLUG promotes prostate cancer cell migration and invasion via CXCR4/CXCL12 axis.
22071114 2012 Increased CXCL12 expression in the placentae of women with pre-eclampsia.
22066471 2012 Processing of CXCL12 by different osteoblast-secreted cathepsins.
22044645 2012 Expression of platelet-bound stromal cell-derived factor-1 in patients with non-valvular atrial fibrillation and ischemic heart disease.
22025564 2011 PGE(2)-induced CXCL12 production and CXCR4 expression controls the accumulation of human MDSCs in ovarian cancer environment.
22025313 2012 Survival outcomes in endometrial cancer patients are associated with CXCL12 and estrogen receptor expression.
22015231 2011 Plasma levels of stromal cell-derived factor-1 in patients with coronary artery disease: effect of clinical presentation and cardiovascular risk factors.
22008312 2011 Evaluation of CXCL10, CXCL11, CXCL12 and CXCL13 chemokines in serum and cerebrospinal fluid in patients with tick borne encephalitis (TBE).
21994039 2012 Bone marrow of neuroblastoma patients shows downregulation of CXCL12 expression and presence of IFN signature.
21968974 2012 Increased circulating levels of SDF-1 (CXCL12) in type 2 diabetic patients are correlated to disease state but are unrelated to polymorphism of the SDF-1? gene in the Iranian population.
21964561 2012 The role of SDF-1?/Rac pathway in the regulation of endothelial progenitor cell polarity; homing and expression of Rac1, Rac2 during endothelial repair.
21960286 2012 Down-regulation of CXCL12 by DNA hypermethylation and its involvement in gastric cancer metastatic progression.
21953583 2012 CXCL12? isoform is expressed on endothelial and dendritic cells in rheumatoid arthritis synovium and regulates T cell activation.
21951424 2012 Expression of stromal-cell-derived factor-1 (SDF-1): a predictor of ischaemic stroke?
21948620 2011 Limbal epithelial stem/progenitor cells attract stromal niche cells by SDF-1/CXCR4 signaling to prevent differentiation.
21921288 2011 Chemokine stimulation promotes enterocyte migration through laminin-specific integrins.
21910857 2011 Myocardial production and release of MCP-1 and SDF-1 following myocardial infarction: differences between mice and man.
21909361 2011 Osteopontin enhances the expression and activity of MMP-2 via the SDF-1/CXCR4 axis in hepatocellular carcinoma cell lines.
21906874 2011 Mesenchymal stromal cells may enhance metastasis of neuroblastoma via SDF-1/CXCR4 and SDF-1/CXCR7 signaling.
21906588 2011 Effects of SDF-1-CXCR4 signaling on microRNA expression and tumorigenesis in estrogen receptor-alpha (ER-?)-positive breast cancer cells.
21878648 2011 Chemokine CXCL12 uses CXCR4 and a signaling core formed by bifunctional Akt, extracellular signal-regulated kinase (ERK)1/2, and mammalian target of rapamycin complex 1 (mTORC1) proteins to control chemotaxis and survival simultaneously in mature dendritic cells.
21878545 2012 Inhibitory effect of semaphorin-3A, a known axon guidance molecule, in the human thymocyte migration induced by CXCL12.
21868522 2011 SDF1? expression in renal cell carcinoma correlates with grading and infiltration by CD8+ T-cells.
21856938 2011 G alpha i2 and ZAP-70 mediate RasGRP1 membrane localization and activation of SDF-1-induced T cell functions.
21856785 2011 MicroRNA-126 modulates endothelial SDF-1 expression and mobilization of Sca-1(+)/Lin(-) progenitor cells in ischaemia.
21853930 2011 SDF-1alpha/CXCL12 and dendritic cells in ovarian cancer microenvironment.
21853036 2011 Serotonin-mediated tuning of human helper T cell responsiveness to the chemokine CXCL12.
21840752 2011 Intratumoural level of SDF-1 correlates with survival in head and neck squamous cell carcinoma.
21818756 2011 B lymphocytes that migrate to tuberculous pleural fluid via the SDF-1/CXCR4 axis actively respond to antigens specific for Mycobacterium tuberculosis.
21802140 2012 SDF-1/CXCR4 axis in myelodysplastic syndromes: correlation with angiogenesis and apoptosis.
21802105 2011 Role for the conserved N-terminal cysteines in the anti-chemokine activities by the chemokine-like protein MC148R1 encoded by Molluscum contagiosum virus.
21781514 2011 [Correlation between the airway inflammations and levels of stromal cell-derived factor 1 in induced sputum of asthmatic patients].
21774929 2011 Progestins inhibit estradiol-induced vascular endothelial growth factor and stromal cell-derived factor 1 in human endometrial stromal cells.
21757744 2011 The CXC chemokine receptor 4 ligands ubiquitin and stromal cell-derived factor-1? function through distinct receptor interactions.
21753787 2011 DNA methylation regulates the expression of CXCL12 in rheumatoid arthritis synovial fibroblasts.
21740294 2012 Enhancement of the anti-tumor activity of therapeutic monoclonal antibodies by CXCR4 antagonists.
21705836 2011 Stromal cell derived factor-1 genetic variation at locus 801 in patients with myasthenia gravis.
21705626 2011 Stromal cell-derived factor-1 signaling via the CXCR4-TCR heterodimer requires phospholipase C-?3 and phospholipase C-?1 for distinct cellular responses.
21695171 2011 Differential estrogen-regulation of CXCL12 chemokine receptors, CXCR4 and CXCR7, contributes to the growth effect of estrogens in breast cancer cells.
21667221 2012 The Consequence of a Founder Effect: CCR5-?32, CCR2-64I and SDF1-3'A Polymorphism in Vlach Gypsy Population in Hungary.
21643956 2012 CXCL12 G801A polymorphism and breast cancer risk: a meta-analysis.
21633638 2011 CXCR4/SDF-1 axis is involved in lymph node metastasis of gastric carcinoma.
21624427 2011 In and out of the niche: perspectives in mobilization of hematopoietic stem cells.
21623830 2011 How the human spermatozoa sense the oocyte: a new role of SDF1-CXCR4 signalling.
21618080 2011 Trafficking of stem cells.
21607655 2011 Stromal-derived factor-1 deficiency in the bone marrow of acute myeloid leukemia.
21607621 2012 Genetic variants of SDF-1 and CXCR4 genes in endometrial carcinoma.
21602126 2011 [Association of CCR5, CCR2 and SDF1 gene polymorphisms with HIV-1 infection in Chinese population: a meta-analysis].
21592819 2011 CXCL12 rs1801157 polymorphism and expression in peripheral blood from breast cancer patients.
21584490 2011 SNP rs1801157 significantly correlates with distant metastasis in CXCL12 expressing esophagogastric cancer.
21567400 2012 Stromal cell-derived factor-1/CXC receptor 4 and ?1 integrin interaction regulates urokinase-type plasminogen activator expression in human colorectal cancer cells.
21527066 2011 Chemokine axes CXCL12/CXCR4 and CXCL16/CXCR6 correlate with lymph node metastasis in epithelial ovarian carcinoma.
21521526 2011 Recruitment of regulatory T cells is correlated with hypoxia-induced CXCR4 expression, and is associated with poor prognosis in basal-like breast cancers.
21518481 2011 [Level of SDF-1/CXCR4 in children with acute leukemia and its significance].
21506920 2011 Clinical and genetic features of Warts, Hypogammaglobulinemia, Infections and Myelokathexis (WHIM) syndrome.
21487523 2011 CXCL12 controls over-invasion of trophoblasts via upregulating CD82 expression in DSCs at maternal-fetal interface of human early pregnancy in a paracrine manner.
21484857 2011 Interleukin-1? stimulates stromal-derived factor-1? expression in human subacromial bursa.
21470957 2011 Olfactomedin 4 suppresses prostate cancer cell growth and metastasis via negative interaction with cathepsin D and SDF-1.
21465475 2012 Urokinase induces stromal cell-derived factor-1 expression in human hepatocellular carcinoma cells.
21463876 2011 Interaction between neoplastic cells and cancer-associated fibroblasts through the CXCL12/CXCR4 axis: role in non-small cell lung cancer tumor proliferation.
21459858 2011 New G-protein-coupled receptor structures provide insights into the recognition of CXCL12 and HIV-1 gp120 by CXCR4.
21444670 2011 Role for stromal heterogeneity in prostate tumorigenesis.
21442287 2011 Expressions of CXCR7/ligands may be involved in oral carcinogenesis.
21440782 2011 Association of stromal cell-derived factor-1-3'A polymorphism to higher mobilization of hematopoietic stem cells CD34+ in Tunisian population.
21435112 2011 Increased levels of circulating SDF-1? and CD34+ CXCR4+ cells in patients with moyamoya disease.
21410972 2011 CXCL12 expression by healthy and malignant ovarian epithelial cells.
21396623 2011 Association of host genetic risk factors with the course of cytomegalovirus retinitis in patients infected with human immunodeficiency virus.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21372218 2011 Phase I dose-escalation study and biomarker analysis of E7080 in patients with advanced solid tumors.
21367627 2013 Stromal cell-derived factor-1 and vascular endothelial growth factor as biomarkers for lymph node metastasis and poor cancer-specific survival in prostate cancer patients after radical prostatectomy.
21361865 2011 Association between polymorphism of SDF1 (CXCL12) gene and HIV-1 susceptibility: a meta-analysis.
21357602 2011 Expression of CXCL12 and CXCR4 in human endometrium; effects of CXCL12 on MMP production by human endometrial cells.
21349998 2011 CXCL12 (SDF1alpha)-CXCR4/CXCR7 pathway inhibition: an emerging sensitizer for anticancer therapies?
21349176 2011 CXC receptor-4 mRNA silencing abrogates CXCL12-induced migration of colorectal cancer cells.
21312072 2012 The influence of intraoperative pleural perfusion with matrine-cisplatin or cisplatin on stromal cell-derived factor-1 in non-small cell lung cancer patients with subclinical pleural metastasis.
21304904 2011 Genetic predisposition of donors affects the allograft outcome in kidney transplantation; polymorphisms of stromal-derived factor-1 and CXC receptor 4.
21298365 2012 CXCL12 G801A polymorphism is associated with an increased risk of benign salivary gland tumors in the Chinese population.
21296802 2011 Haplotype analysis of chemokine CXCL12 polymorphisms and susceptibility to premature ovarian failure in Chinese women.
21292343 2011 Association of genetic polymorphisms of CXCL12/SDF1 gene and its receptor, CXCR4, to the susceptibility and prognosis of non-small cell lung cancer.
21257825 2011 Stromal-derived factor-1[alpha] correlates with circulating endothelial progenitor cells and with acute lesion volume in stroke patients.
21186999 2011 Stromal-derived factor-1/CXCR4 signaling: indispensable role in homing and engraftment of hematopoietic stem cells in bone marrow.
21182836 2011 Slug contributes to the regulation of CXCL12 expression in human osteoblasts.
21179442 2010 MiR-886-3p down regulates CXCL12 (SDF1) expression in human marrow stromal cells.
21158728 2010 CXCL12-CXCR4 axis in angiogenesis, metastasis and stem cell mobilization.
21148034 2011 G?13 and Rho mediate endosomal trafficking of CXCR4 into Rab11+ vesicles upon stromal cell-derived factor-1 stimulation.
21147466 2010 A pivotal role for CXCL12 signaling in HPV-mediated transformation of keratinocytes: clues to understanding HPV-pathogenesis in WHIM syndrome.
21132258 2011 Cyclic variability of stromal cell-derived factor-1 and endothelial progenitor cells during the menstrual cycle.
21091093 2011 Polymorphisms in chemokine and receptor genes and gastric cancer risk and survival in a high risk Polish population.
21087507 2010 Effects of human mesenchymal stem cells on ER-positive human breast carcinoma cells mediated through ER-SDF-1/CXCR4 crosstalk.
21082982 2010 CXCL12 and CXCR4 in bone marrow physiology.
21080209 2012 Modulating the interaction of CXCR4 and CXCL12 by low-molecular-weight heparin inhibits hepatic metastasis of colon cancer.
21071025 2011 Concentrations of stromal cell-derived factor-1 and vascular endothelial growth factor in relation to the diameter of human follicles.
21059341 2010 Involvement of autocrine CXCL12/CXCR4 system in the regulation of ovarian carcinoma cell invasion.
21041659 2010 Autocrine TGF-beta and stromal cell-derived factor-1 (SDF-1) signaling drives the evolution of tumor-promoting mammary stromal myofibroblasts.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20970672 2010 CXCL12 gene polymorphism and hematologic recovery after transplantation of peripheral blood progenitor cells.
20923761 2010 Classical NF-kappaB activation negatively regulates noncanonical NF-kappaB-dependent CXCL12 expression.
20889568 2010 Stromal cell-derived factor-1 is essential for photoreceptor cell protection in retinal detachment.
20887389 2010 CXCR7: a new SDF-1-binding receptor in contrast to normal CD34(+) progenitors is functional and is expressed at higher level in human malignant hematopoietic cells.
20877573 2010 CXCL12 chemokine expression and secretion regulates colorectal carcinoma cell anoikis through Bim-mediated intrinsic apoptosis.
20869048 2011 Estrogen induces stromal cell-derived factor 1 (SDF-1/CXCL12) production in human endometrial stromal cells: a possible role of endometrial epithelial cell growth.
20865359 2011 Changes in CXCL12/CXCR4-chemokine expression during onset of colorectal malignancies.
20854168 2011 SDF-1? secreted by human CD133-derived multipotent stromal cells promotes neural progenitor cell survival through CXCR7.
20851290 2010 Assessment of CXCL12 (SDF-1?) polymorphisms and its serum level in posttransfusion occult HBV-infected patients in Southeastern Iran.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
20728717 2010 Regulation of the stromal cell-derived factor-1alpha-CXCR4 axis in human dental pulp cells.
20725607 2009 CCL3 genotype and current depression increase risk of HIV-associated dementia.
20695076 2009 CXCL12/SDF-1 alpha activates NF-kappaB and promotes oral cancer invasion through the Carma3/Bcl10/Malt1 complex.
20694560 2011 Common genetic polymorphisms in moyamoya and atherosclerotic disease in Europeans.
20661426 2010 Elucidating the CXCL12/CXCR4 signaling network in chronic lymphocytic leukemia through phosphoproteomics analysis.
20646340 Decreased interstitial FOXP3(+) lymphocytes in usual interstitial pneumonia with discrepancy of CXCL12/CXCR4 axis.
20637871 2010 Can inhibition of the SDF-1/CXCR4 axis eradicate acute leukemia?
20634887 2010 Polycomb target genes are silenced in multiple myeloma.
20631377 2010 Low-dose radiation augments vasculogenesis signaling through HIF-1-dependent and -independent SDF-1 induction.
20629629 2010 CXCR4-CXCL12-dependent inflammatory network and endothelial progenitors.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622326 2010 Impact of genetic polymorphism of SDF1 3A on efficacy of captopril in Chinese patients with essential hypertension.
20622011 2010 The Epstein-Barr virus-encoded G protein-coupled receptor BILF1 hetero-oligomerizes with human CXCR4, scavenges G?i proteins, and constitutively impairs CXCR4 functioning.
20609598 2011 CXCL12 gene expression is upregulated by hypoxia and growth arrest but not by inflammatory cytokines in rheumatoid synovial fibroblasts.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.