Property Summary

NCBI Gene PubMed Count 1,114
PubMed Score 3085.89
PubTator Score 1837.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (35)

Disease log2 FC p
Breast cancer -2.400 3.1e-02
adrenocortical carcinoma -1.538 1.9e-04
aldosterone-producing adenoma -1.681 2.5e-02
Alzheimer's disease 1.300 3.5e-02
Atopic dermatitis -2.000 7.9e-03
atypical teratoid / rhabdoid tumor -1.400 2.2e-02
breast carcinoma -1.900 2.8e-05
colon cancer -2.100 2.2e-02
cystic fibrosis 1.295 3.7e-04
Duchenne muscular dystrophy 1.655 3.5e-08
ductal carcinoma in situ -1.600 1.9e-03
fibroadenoma -1.600 8.3e-03
glioblastoma 1.200 8.6e-03
group 4 medulloblastoma -1.200 1.6e-02
interstitial cystitis 1.900 3.6e-04
intraductal papillary-mucinous adenoma (... -2.800 8.0e-06
intraductal papillary-mucinous carcinoma... -2.400 6.9e-04
intraductal papillary-mucinous neoplasm ... -2.800 4.5e-04
invasive ductal carcinoma -1.126 1.7e-03
limb girdle muscular dystrophy 2A 1.099 4.2e-04
lung adenocarcinoma -1.700 2.3e-05
lung cancer -1.300 2.6e-02
lung carcinoma -1.400 3.7e-10
medulloblastoma, large-cell -1.900 1.7e-04
mucosa-associated lymphoid tissue lympho... 2.738 1.8e-02
non-small cell lung cancer -1.923 5.7e-13
osteosarcoma -5.407 8.0e-06
ovarian cancer -2.600 5.1e-05
pancreatic cancer -1.400 2.9e-04
pancreatic ductal adenocarcinoma liver m... -2.232 3.7e-02
periodontitis 1.200 6.8e-31
Pick disease 1.400 6.6e-03
primary Sjogren syndrome 1.400 1.6e-03
subependymal giant cell astrocytoma 3.236 3.1e-02
Waldenstrons macroglobulinemia -1.144 1.4e-02

PDB (20)

Gene RIF (1149)

AA Sequence

MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV      1 - 70
CIDPKLKWIQEYLEKALNKRFKM                                                    71 - 93
//

Text Mined References (1124)

PMID Year Title