Property Summary

NCBI Gene PubMed Count 90
PubMed Score 491.15
PubTator Score 334.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
interstitial cystitis 3.900 3.3e-02
urothelial carcinoma -3.000 2.5e-02
cutaneous lupus erythematosus 5.200 3.4e-04
glioblastoma 1.500 6.2e-04
medulloblastoma, large-cell 1.800 1.2e-02
juvenile dermatomyositis 3.668 4.3e-11
intraductal papillary-mucinous adenoma (... -2.000 3.7e-03
colon cancer 2.600 2.9e-02
lung cancer -1.200 3.6e-04
active Crohn's disease 3.297 3.5e-03
ulcerative colitis 4.900 1.3e-05
sarcoidosis 3.200 1.8e-02
cystic fibrosis 3.300 1.3e-02
adult high grade glioma 2.100 3.6e-05
posterior fossa group A ependymoma 1.200 4.4e-03
primary Sjogren syndrome 2.200 6.9e-05
invasive ductal carcinoma 4.600 1.5e-04
nasopharyngeal carcinoma 4.000 9.8e-09
psoriasis 2.700 7.1e-41
Breast cancer 2.100 1.5e-04
lung carcinoma -1.100 1.1e-03
breast carcinoma 1.700 2.5e-22
ductal carcinoma in situ 2.000 4.8e-02
head and neck cancer 4.200 4.8e-04
head and neck cancer and chronic obstruc... 2.500 2.5e-02

Gene RIF (72)

PMID Text
26506526 congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP.
26275808 higher concentration is associated with neutrophils accumulation in the alveolar space of Systemic Lupus Erythematosus patients with pulmonary fibrosis
26116899 HIV-1 Vpr upregulates the expression of CXCL11 in human monocyte-derived dendritic cells
25890876 Resveratrol substantially inhibited the proinflammatory cytokines-induced CXCL11 production while partially blocking nuclear factor-kappaB activation.
25858769 Common variants of CXCR3 and its ligands CXCL10 and CXCL11 are associated with vascular permeability of dengue infection in peninsular Malaysia.
25810367 Developmental expression patterns of chemokines CXCL11, CXCL12 and their receptor CXCR7 in testes
25713416 These findings functionally integrate K17, hnRNP K, and gene expression along with RSK and CXCR3 signaling in a keratinocyte-autonomous axis and provide a potential basis for their implication in tumorigenesis
25605062 Cyclic stretch significantly induced ESC secretion of CXCL8 and CXCL1 and neutrophil chemotaxis. Stretch also increased MMP-1, MMP-2, and MMP-3 activity, activin A secretion, and activity in ESC.
25559603 The homozygosity for the CXCL9 rs10336 (T), CXCL10 rs3921 (G), and CXCL11 rs4619915 (A) alleles is associated with the higher likelihood of significant liver fibrosis in HIV-infected patients coinfected with hepatitis C virus genotype 1.
25251331 High CXCL11 expression is associated with acute cellular rejection.
24526602 The chemokine CXCL11 is produced by mesenchymal stem cells and interacts with CXCR3.
24104601 Although TARC and I-TAC may not directly regulate pruritus in atopic dermatitis patients, these chemokines are very sensitive disease markers of AD.
24063316 CXCL11 was mildlylavage fluid during diffuse alveolar damage, but not during acute rejection or lymphocytic bronchiolitis. Elevated CXCL11 was associated with increased risk of chronic allograft dysfunction.
23985752 The expression of MIF mRNA was compared with VEGF mRNA expression and with mRNA expression of other chemokines related to neo-angiogenesis, such as CXCL12, CXCL11, CXCL8 and CXCR4, in human endometrial cancer tissue and normal endometrium.
23600831 CXCR3 ligands CXCL10, CXCL9 and CXCL11 were measured in 245 children with opsoclonus-myoclonus syndrome and 81 controls.
23559389 Th1 chemokines CXCL11 and CXCL10 may be involved in the pathogenesis of mixed cryoglobulinemia; IL-6 and CCL2 may be involved in regulating their elevation
23527708 Our study demonstrates in mixed cryoglobulinemia and hepatitis C vs controls: (i)high serum CXCL9 and CXCL11, significantly associated with the presence of active vasculitis; (ii) a strong relationship between circulating CXCL9 and CXCL11
23225384 This study demonistrated that CXCL11, absent from normal muscle fibers, were induced in DMD myofibers. and up regulattion on blood vessel endothelium of DMD patients.
23158864 There was no difference in expression of I-TAC between immune thrombocytopenic purpura patients and healthy controls.
23012327 In chronic graft-vs-host disease, increased levels of the Th1-associated chemokines CXCL9, CXCL10, and CXCL11 led to recruitment of CXCR3+ T cells from the peripheral blood into affected tissues.
22691213 Elevated BALF concentrations of CXCL11 in systemic sclerosis patients who do not developed lung fibrosis suggest that determination of CXCL11 in BALF could serve as a prognostic factor for pulmonary function decline.
22367045 Expression of CXCL9, -10, and -11 chemokines and their receptor CXCR3 increases in the aqueous humor of patients with herpetic endotheliitis.
22168752 circulating CXCL11, together with CXCL10, is increased in patients with thyroiditis and hypothyroidism, and is related to CXCL10 levels.
22160826 Our study first demonstrates higher serum levels of CXCL11 chemokine in patients with mixed cryoglobulinemia than in hepatitis C virus-positive patients, and in particular in the presence of autoimmune thyroiditis.
22008312 CXCL10, CXCL11, CXCL12 and CXCL13 chemokines are biomarkers in serum and cerebrospinal fluid in patients with tick borne encephalitis
21962843 Elevated plasma levels of interferon-gamma and Cys-X-Cys chemokine receptor 3-binding chemokine CXCL11 are present in patients with thoracic aortic aneurysms.
21724697 A strong relationship between circulating IFN-gamma and CXCL11 is shown, supporting the role of a T helper (Th)1 cell immune response in the pathogenesis of mixed cryoglobulinemia and hepatitis C.
21645215 CXCR3 ligands, CXCL9,10,11, are differentially expressed during chronic liver diseases across different disease stages and aetiologies.
21470996 We first show that circulating CXCL9 and CXCL11 are increased in patients with thyroiditis and hypothyroidism and are related to each other.
21442287 positive ratios of CXCR7, CXCL12 and CXCL11 in oral leukoplakia and oral squamous cell carcinoma tissues respectively, were significantly higher than that in normal epithelia
21438871 involved in microbial-induced intestinal inflammation and Th17 cell development in ulcerative colitis
20848514 Observational study of gene-disease association. (HuGE Navigator)
20810571 A potent dose-dependent inhibition by PPARalpha-agonists was observed on the cytokines-stimulated secretion of CXCL11 in Graves disease and in primary thyrroid culture.
20529825 The expression and function of CXCR3 and CXCR7 receptors in cervical carcinoma, rhabdomyosarcoma and glioblastoma cell lines, was evaluated.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20036838 Studies indicate that CXCR7 is an interceptor for CXCL12 and CXCL11.
19939453 TNFSF14 enhanced IFN-gamma-induced secretion of CXCL10 and CXCL11 from human gingival fibroblasts.
19875106 Studies indicate that I-TAC-targeted intervening strategies would have potential application for the alleviation of acute transplant rejection.
19800124 The three-dimensional structure of CXCL9 and CXCR3, and, successively, of the CXCL9/CXCR3 complex were modelled in comparison to CXCL10/CXCR3 and CXCL11/CXCR3 complexes.
19274094 SpeB destroys most of the signaling and antibacterial properties of chemokines expressed by an inflamed epithelium.
19175890 Development of allergic disease is associated with a more marked Th2-like deviation already at birth, shown as increased levels of cord blood IgE and MDC (CCL22) and higher ratios of MDC (CCL22) to IP-10 (CXCL10) and I-TAC (CXCL11).
18669615 IP-9 is a key ligand in the CXCR3 signaling system for wound repair
18645041 These data provide new structure-function dimensions for chemokines in leukocyte mobilization, disclosing an anti-inflammatory role for PAD.
18515987 There are elevated concentrations of the chemokines MDC, eotaxin, I-TAC, and MCP-1 in malignant pleural effusions.
18411283 potential new roles in down-regulating Th1 lymphocyte chemoattraction through MMP processing of CXCL11.
18316607 CXCL-11 is targeted by ebv-mir-BHRF1-3 in primary lymphomas
18275857 DP8 cleavage of the N-terminal two residues of IP10 (CXCL10), ITAC (CXCL11) and SDF-1 (CXCL12), is reported.
18258269 Data show that RIG-I mRNA and protein are expressed in HeLa cells stimulated with IFN-gamma, and that RNA interference against RIG-I results in the suppression of IFN-gamma-induced CXCL11 expression.
18209084 Egression of human T cells across the bronchial epithelium is a multistep process, driven in part by a polarized transepithelial gradient of CXCL11 that is up-regulated in patients with chronic obstructive airways disease.
17363734 CD13 rapidly processed CXCL11, but not CXCL8, to generate truncated CXCL11 forms that had reduced binding, signaling, and chemotactic properties for lymphocytes and CXCR3- or CXCR7-transfected cells.
17255201 prolactin may enhance IFN-gamma-induced CXCL9, CXCL10, and CXCL11 production in keratinocytes
17142784 IFN-gamma promotes implantation by stimulating EEC to produce CXCL11, which induces migration of trophoblast cells and T cells, proliferation of ESC, and apoptosis of EEC.
16368892 CXCL11-dependent CXCR3 internalization and cell migration are regulated by the CXCR3 membrane proximal carboxyl terminus, whereas adhesion is regulated by the 3i loop S245.
16358960 Increased I-TAC levels in blood and cerebrospinal fluid is associated with Lyme borreliosis
16210647 This CSCR3 ligand has the ability to activate biochemical (e.g., PtdIns and MAP kinase activation) and functional events (actin reorganization) in intestinal myofibroblasts.
16200621 Increased expression of the interferon-induced angiostatic ELR- CXC chemokines is a feature of juvenile DM that parallels the degree of vasculopathy in patients with the disease
16081539 autocrine-acting CXCL11 mediates, at least in part, the regulations of osteoclastogenesis by type I interferons
15885315 CXCL11 creates a chemokine gradient between the cerebrospinal fluid (CSF) and serum and recruits CXCR3-expressing memory CD4+ T-cells into the CSF of neuroborreliosis patients.
15814716 recruitment might enhance the sequestration of T cells in infected lymphoid organs and the spread of infection between cells, contributing to the immunopathology of AIDS
15653416 novel I-TAC -599del5 promoter polymorphism is a functional variant in the presence of replicating HCV and may predispose to HCV disease susceptibility.
15308116 ductal epithelial cells produce I-TAC proteins in response to stimulation with IFNgamma secreted by lymphocytes
15150261 CXCL9, CXCL10, and CXCL11 functions are mediated by intracellular domains of CXCR3
15122750 I-TAC, one of the most potent chemoattractants for activated T cells, is produced by hepatocytes in the HCV-infected liver and plays an important role in T cell recruitment and ultimately the pathogenesis of chronic hepatitis C
12949249 CXCL11 displays antimicrobial activity against E. coli and S. aureus.
12884299 CXCR3 ligands inhibit CCR3-mediated functional responses of both human eosinophils and CCR3 transfectants induced by all three eotaxins, with CXCL11 being the most efficacious antagonist.
12847282 A higher amount of I-TAC mRNA is expressed after exposure of keratinocytes to interferon-gamma, leading to migration of T cells from the dermis to the epidermis and representing a second step of chemotaxis following T cell recruitment from blood.
12787142 increased calpain activity in undifferentiated keratinocytes. inhibited calpain activity in fibroblasts. redifferentiated basal keratinocytes limit fibroblast repopulation of dermis of healed wounds while promoting re-epithelialization.
12695288 Levels of ITAC/CXCL11 were found elevated in patients with severe transplantation coronary artery disease (TCAD) compared with long-term survivors of transplantation without TCAD and healthy volunteers who had not undergone transplantation
12169689 These data suggest that IFN-beta acts through PI3K to enhance the transactivation competence of NF-kappa B complexes through phosphorylation of p65 within the TAD of beta-R1.
12162873 The IFN-gamma-inducible T cell alpha-chemoattractant was induced in human brain microvascular endothelial cells and astrocytes only after inflammatory stimuli.
12055261 I-TAC is a highly potent chemoattractant of normal blood CD4 and CD8 T cell transendothelial migration and a major mediator of blood memory T lymphocyte migration to inflammation.
11559369 chemotactic activity for CXCR3-expressing cells; substrate for dipeptidylpeptidase IV

AA Sequence

MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENK      1 - 70
GQRCLNPKSKQARLIIKKVERKNF                                                   71 - 94
//

Text Mined References (90)

PMID Year Title
26506526 2015 Left Ventricular Dysfunction and CXCR3 Ligands in Hypertension: From Animal Experiments to a Population-Based Pilot Study.
26275808 2015 The Role of CXC Chemokines in Pulmonary Fibrosis of Systemic Lupus Erythematosus Patients.
25890876 2015 Resveratrol attenuates CXCL11 expression induced by proinflammatory cytokines in retinal pigment epithelial cells.
25858769 2015 Common variants of chemokine receptor gene CXCR3 and its ligands CXCL10 and CXCL11 associated with vascular permeability of dengue infection in peninsular Malaysia.
25810367 2015 Developmental expression patterns of chemokines CXCL11, CXCL12 and their receptor CXCR7 in testes of common marmoset and human.
25713416 2015 Regulation of C-X-C chemokine gene expression by keratin 17 and hnRNP K in skin tumor keratinocytes.
25605062 2015 Cyclic stretch augments production of neutrophil chemokines, matrix metalloproteinases, and activin a in human endometrial stromal cells.
25559603 2015 Single nucleotide polymorphisms of CXCL9-11 chemokines are associated with liver fibrosis in HIV/HCV-coinfected patients.
25416956 2014 A proteome-scale map of the human interactome network.
25251331 2014 Immunosuppressive therapies after intestinal transplant modulate the expression of Th1 signature genes during acute cellular rejection. Implications in the search for rejection biomarkers.
24526602 2014 The involvement of CXCL11 in bone marrow-derived mesenchymal stem cell migration through human brain microvascular endothelial cells.
24104601 2014 Variations in serum TARC and I-TAC levels reflect minor changes in disease activity and pruritus in atopic dermatitis.
24063316 2013 CXCR3 ligands are associated with the continuum of diffuse alveolar damage to chronic lung allograft dysfunction.
23985752 2013 Chemokines mRNA expression in relation to the Macrophage Migration Inhibitory Factor (MIF) mRNA and Vascular Endothelial Growth Factor (VEGF) mRNA expression in the microenvironment of endometrial cancer tissue and normal endometrium: a pilot study.
23600831 2013 Expression of CXCR3 and its ligands CXCL9, -10 and -11 in paediatric opsoclonus-myoclonus syndrome.
23559389 2013 Parallel increase of circulating CXCL11 and CXCL10 in mixed cryoglobulinemia, while the proinflammatory cytokine IL-6 is associated with high serum Th2 chemokine CCL2.
23527708 High circulating chemokines (C-X-C motif) ligand 9, and (C-X-C motif) ligand 11, in hepatitis C-associated cryoglobulinemia.
23225384 2012 Upregulation of chemokines and their receptors in Duchenne muscular dystrophy: potential for attenuation of myofiber necrosis.
23158864 2012 [The role of CXCR3 and its ligand I-TAC in the pathogenesis of immune thrombocytopenic purpura].
23012327 2012 Chemokine-mediated tissue recruitment of CXCR3+ CD4+ T cells plays a major role in the pathogenesis of chronic GVHD.
22691213 CXCL11 in bronchoalveolar lavage fluid and pulmonary function decline in systemic sclerosis.
22367045 2012 Expression of CXCL9, -10, and -11 in the aqueous humor of patients with herpetic endotheliitis.
22168752 2012 High levels of circulating chemokine (C-X-C motif) ligand 11 are associated with euthyroid or subclinically hypothyroid autoimmune thyroiditis and with chemokine (C-X-C motif) ligand 10.
22160826 2012 Circulating CXCL11 and CXCL10 are increased in hepatitis C-associated cryoglobulinemia in the presence of autoimmune thyroiditis.
22008312 2011 Evaluation of CXCL10, CXCL11, CXCL12 and CXCL13 chemokines in serum and cerebrospinal fluid in patients with tick borne encephalitis (TBE).
21962843 2012 Circulating interferon-?-inducible Cys-X-Cys chemokine receptor 3 ligands are elevated in humans with aortic aneurysms and Cys-X-Cys chemokine receptor 3 is necessary for aneurysm formation in mice.
21724697 2011 High serum levels of CXCL11 in mixed cryoglobulinemia are associated with increased circulating levels of interferon-?.
21645215 2011 Serum chemokine receptor CXCR3 ligands are associated with progression, organ dysfunction and complications of chronic liver diseases.
21470996 2011 Increase of circulating CXCL9 and CXCL11 associated with euthyroid or subclinically hypothyroid autoimmune thyroiditis.
21442287 2011 Expressions of CXCR7/ligands may be involved in oral carcinogenesis.
21438871 2011 Chemokine CXCL11 links microbial stimuli to intestinal inflammation.
21314817 2011 Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-?.
20848514 2010 Strong overexpression of CXCR3 axis components in childhood inflammatory bowel disease.
20810571 2010 CXCL9 and CXCL11 chemokines modulation by peroxisome proliferator-activated receptor-alpha agonists secretion in Graves' and normal thyrocytes.
20529825 2010 Role of I-TAC-binding receptors CXCR3 and CXCR7 in proliferation, activation of intracellular signaling pathways and migration of various tumor cell lines.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20036838 2010 Chemokine patterning by glycosaminoglycans and interceptors.
19939453 2010 TNFSF14 coordinately enhances CXCL10 and CXCL11 productions from IFN-gamma-stimulated human gingival fibroblasts.
19875106 2010 I-TAC is a dominant chemokine in controlling skin intragraft inflammation via recruiting CXCR3+ cells into the graft.
19800124 2009 Modelling of the membrane receptor CXCR3 and its complexes with CXCL9, CXCL10 and CXCL11 chemokines: putative target for new drug design.
19274094 2009 SpeB of Streptococcus pyogenes differentially modulates antibacterial and receptor activating properties of human chemokines.
19175890 2009 Cord blood cytokines and chemokines and development of allergic disease.
18669615 2008 ELR-negative CXC chemokine CXCL11 (IP-9/I-TAC) facilitates dermal and epidermal maturation during wound repair.
18645041 2008 Citrullination of CXCL10 and CXCL11 by peptidylarginine deiminase: a naturally occurring posttranslational modification of chemokines and new dimension of immunoregulation.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18515987 2008 The local cytokine and chemokine milieu within malignant effusions.
18411283 2008 Matrix metalloproteinase processing of CXCL11/I-TAC results in loss of chemoattractant activity and altered glycosaminoglycan binding.
18316607 2008 EBV microRNAs in primary lymphomas and targeting of CXCL-11 by ebv-mir-BHRF1-3.
18275857 2008 Stromal cell-derived factors 1alpha and 1beta, inflammatory protein-10 and interferon-inducible T cell chemo-attractant are novel substrates of dipeptidyl peptidase 8.
18258269 2008 Retinoic acid-inducible gene-I is induced by interferon-gamma and regulates CXCL11 expression in HeLa cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18209084 2008 Polarized localization of epithelial CXCL11 in chronic obstructive pulmonary disease and mechanisms of T cell egression.
17363734 2007 Proteolytic processing of CXCL11 by CD13/aminopeptidase N impairs CXCR3 and CXCR7 binding and signaling and reduces lymphocyte and endothelial cell migration.
17255201 2007 Prolactin enhances interferon-gamma-induced production of CXC ligand 9 (CXCL9), CXCL10, and CXCL11 in human keratinocytes.
17142784 2006 The expression and possible roles of chemokine CXCL11 and its receptor CXCR3 in the human endometrium.
16368892 2006 Role of CXCR3 carboxyl terminus and third intracellular loop in receptor-mediated migration, adhesion and internalization in response to CXCL11.
16358960 2005 Concentration of interferon-inducible T cell chemoattractant and monocyte chemotactic protein-1 in serum and cerebrospinal fluid of patients with Lyme borreliosis.
16210647 2005 The chemokines CXCL9, CXCL10, and CXCL11 differentially stimulate G alpha i-independent signaling and actin responses in human intestinal myofibroblasts.
16200621 2005 Association between lack of angiogenic response in muscle tissue and high expression of angiostatic ELR-negative CXC chemokines in patients with juvenile dermatomyositis: possible link to vasculopathy.
16081539 2005 Interferon-alpha and -beta differentially regulate osteoclastogenesis: role of differential induction of chemokine CXCL11 expression.
15885315 2005 Increased expression of CXCR3 and CCR5 on memory CD4+ T-cells migrating into the cerebrospinal fluid of patients with neuroborreliosis: the role of CXCL10 and CXCL11.
15814716 2005 Roles for CXC chemokine ligands 10 and 11 in recruiting CD4+ T cells to HIV-1-infected monocyte-derived macrophages, dendritic cells, and lymph nodes.
15653416 2005 A novel I-TAC promoter polymorphic variant is functional in the presence of replicating HCV in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15308116 2004 Expression of interferon-inducible T cell alpha chemoattractant (CXCL11) in the salivary glands of patients with Sjögren's syndrome.
15273303 2004 NMR structure of CXCR3 binding chemokine CXCL11 (ITAC).
15150261 2004 Intracellular domains of CXCR3 that mediate CXCL9, CXCL10, and CXCL11 function.
15122750 2004 Expression of the CXCR3 ligand I-TAC by hepatocytes in chronic hepatitis C and its correlation with hepatic inflammation.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12884299 2003 CCR3 functional responses are regulated by both CXCR3 and its ligands CXCL9, CXCL10 and CXCL11.
12847282 2003 A second step of chemotaxis after transendothelial migration: keratinocytes undergoing apoptosis release IFN-gamma-inducible protein 10, monokine induced by IFN-gamma, and IFN-gamma-inducible alpha-chemoattractant for T cell chemotaxis toward epidermis in atopic dermatitis.
12787142 2003 Glu-Leu-Arg-negative CXC chemokine interferon gamma inducible protein-9 as a mediator of epidermal-dermal communication during wound repair.
12782716 2003 An alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth induced by IP-10, Mig, and I-TAC, and acts as functional receptor for platelet factor 4.
12695288 2003 Elevated serum levels of the CXCR3 chemokine ITAC are associated with the development of transplant coronary artery disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12169689 2002 Requirement of phosphoinositide 3-kinase and Akt for interferon-beta-mediated induction of the beta-R1 (SCYB11) gene.
12162873 2002 Expression and modulation of IFN-gamma-inducible chemokines (IP-10, Mig, and I-TAC) in human brain endothelium and astrocytes: possible relevance for the immune invasion of the central nervous system and the pathogenesis of multiple sclerosis.
12126650 2002 Molecular cloning and sequencing of 25 different rhesus macaque chemokine cDNAs reveals evolutionary conservation among C, CC, CXC, AND CX3C families of chemokines.
11559369 2001 Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity.
11390394 2001 Kinetic investigation of chemokine truncation by CD26/dipeptidyl peptidase IV reveals a striking selectivity within the chemokine family.
11110785 2001 The ligands of CXC chemokine receptor 3, I-TAC, Mig, and IP10, are natural antagonists for CCR3.
10395932 1999 Genomic organization, sequence and transcriptional regulation of the human CXCL 11(1) gene.
10386863 1999 Structure and expression of the human small cytokine B subfamily member 11 (SCYB11/formerly SCYB9B, alias I-TAC) gene cloned from IFN-gamma-treated human monocytes (THP-1).
10233762 1999 Human IP-9: A keratinocyte-derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3).
10065899 1998 The CXC-chemokine, H174: expression in the central nervous system.
9730616 1998 The human gene encoding SCYB9B, a putative novel CXC chemokine, maps to human chromosome 4q21 like the closely related genes for MIG (SCYB9) and INP10 (SCYB10).
9625760 1998 Interferon-inducible T cell alpha chemoattractant (I-TAC): a novel non-ELR CXC chemokine with potent activity on activated T cells through selective high affinity binding to CXCR3.
9370294 1997 A genetic selection for isolating cDNAs encoding secreted proteins.
8798467 1996 Characterization of beta-R1, a gene that is selectively induced by interferon beta (IFN-beta) compared with IFN-alpha.