Property Summary

NCBI Gene PubMed Count 454
PubMed Score 1760.42
PubTator Score 1180.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 6.94206032756188E-33
juvenile dermatomyositis 1189 1.67185856975896E-9
lung carcinoma 2844 2.13769198389077E-9
nasopharyngeal carcinoma 1056 1.44568140703484E-8
malignant mesothelioma 3163 7.63562296444771E-7
Breast cancer 3099 1.22163072992655E-6
cutaneous lupus erythematosus 1056 3.31538267011386E-6
lung cancer 4473 6.58399938052024E-6
primary Sjogren syndrome 789 2.36596417435391E-5
posterior fossa group A ependymoma 1511 5.68471639958123E-5
ulcerative colitis 2087 6.66933558103963E-5
adult high grade glioma 2148 9.84616692625901E-5
invasive ductal carcinoma 2950 4.57216315368804E-4
head and neck cancer 270 9.93810387083688E-4
pancreatic cancer 2300 0.00279792930306902
cystic fibrosis 1670 0.00320659477814706
active Crohn's disease 918 0.00331809344097457
atypical teratoid / rhabdoid tumor 4369 0.00659778488617704
glioblastoma 5572 0.00738511666799161
colon cancer 1475 0.0181788157835805
facioscapulohumeral dystrophy 286 0.0251588301588639
ductal carcinoma in situ 1745 0.0271918677048041
lung adenocarcinoma 2714 0.0295048541512797
sarcoidosis 368 0.0415519432416586
head and neck cancer and chronic obstructive pulmonary disease 237 0.0440623980652767
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0483105569533244

Expression

Synonym

Accession P02778 Q96QJ5
Symbols C7
IFI10
INP10
IP-10
crg-2
mob-1
SCYB10
gIP-10

Gene

PDB

1LV9   1O7Y   1O7Z   1O80  

  Ortholog (8)

Gene RIF (445)

PMID Text
27012046 Findings indicate high sensitivity and specificity of IP-10 as a novel biomarker for tuberculosis in China.
26907493 ANDV caused long-term elevated levels of eotaxin-1, IL-6, IL-8, IP-10, and VEGF-A that peaked 20-25 days after infection
26881918 Our results suggested that TNF-alpha may be an ideal biomarker for diagnosing the 3 forms of TB presentation, while the other factors (IL-6, IP-10, MCP-1, and IFN-gamma) can potentially facilitate differential diagnosis for the 3 TB presentation types
26861446 Metformin simultaneously increases VEGFA and reduces CXCL10 and TIMP1 in CD34(+) cells in a model of the diabetic state combined with hypoxia to stimulate angiogenesis.
26831417 Both CXCL10 and CXCR3 appeared to be useful in differentiating T1R reaction in borderline leprosy while CXCR3 alone differentiated BT from BT-T1R
26786652 Report use of up-converting phosphor reporter technology in a lateral flow based test to determine IP-10 levels in pleural effusions and whole blood for tuberculosis diagnosis.
26771653 Interferon Gamma Inducible Protein 10 can be used as a Potential Biomarker in the Diagnosis of Latent Tuberculosis Infection
26708691 increased serum levels in 22q11.2 Deletion Syndrome patients
26687629 The results suggested that astrocytes contribute to Cerebral Malaria pathogenesis by producing CXCL10 in response to IFN-gamma and LT-alpha.
26658573 serum level preoperative period may serve as a predictive parameter for early liver allograft dysfunction
More...

AA Sequence

MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG      1 - 70
EKRCLNPESKAIKNLLKAVSKERSKRSP                                               71 - 98
//

Text Mined References (454)

PMID Year Title
27012046 2016 Evaluation of a Whole Blood Chemiluminescent Immunoassay of Interferon-gamma Inducible Protein 10 (IP-10) for Diagnosis of Tuberculosis Patients.
26907493 2016 Andes Hantavirus-Infection of a 3D Human Lung Tissue Model Reveals a Late Peak in Progeny Virus Production Followed by Increased Levels of Proinflammatory Cytokines and VEGF-A.
26881918 2016 Analysis of Plasma Cytokine and Chemokine Profiles in Patients with and without Tuberculosis by Liquid Array-Based Multiplexed Immunoassays.
26861446 2016 Metformin improves the angiogenic potential of human CD34? cells co-incident with downregulating CXCL10 and TIMP1 gene expression and increasing VEGFA under hyperglycemia and hypoxia within a therapeutic window for myocardial infarction.
26831417 2015 Is CXCL10/CXCR3 axis overexpression a better indicator of leprosy type 1 reaction than inducible nitric oxide synthase?
26786652 2016 Use of lateral flow assays to determine IP-10 and CCL4 levels in pleural effusions and whole blood for TB diagnosis.
26771653 2016 The Use of Interferon Gamma Inducible Protein 10 as a Potential Biomarker in the Diagnosis of Latent Tuberculosis Infection in Uganda.
26708691 2016 Increased Levels of Interferon-Inducible Protein 10 (IP-10) in 22q11.2 Deletion Syndrome.
26687629 2016 Synergistic induction of CXCL10 by interferon-gamma and lymphotoxin-alpha in astrocytes: Possible role in cerebral malaria.
26658573 2016 Interferon-?, interleukin-10 and interferon-inducible protein 10 (CXCL10) as serum biomarkers for the early allograft dysfunction after liver transplantation.
More...