Property Summary

NCBI Gene PubMed Count 519
PubMed Score 1942.10
PubTator Score 1180.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (27)

Disease log2 FC p
psoriasis 3.200 2.3e-03
active Crohn's disease 2.460 3.3e-03
active ulcerative colitis 2.347 1.2e-02
adult high grade glioma 2.300 9.8e-05
atypical teratoid / rhabdoid tumor 1.500 6.6e-03
Breast cancer 2.800 1.2e-06
breast carcinoma 1.500 8.3e-04
colon cancer 1.700 1.8e-02
cutaneous lupus erythematosus 6.600 3.3e-06
cystic fibrosis 3.200 3.2e-03
ductal carcinoma in situ 2.700 2.7e-02
ependymoma 1.300 1.7e-03
facioscapulohumeral dystrophy 1.400 2.5e-02
glioblastoma 1.900 1.4e-05
head and neck cancer 4.600 9.9e-04
head and neck cancer and chronic obstruc... 2.200 4.4e-02
intraductal papillary-mucinous adenoma (... -1.700 4.8e-02
invasive ductal carcinoma 2.294 1.4e-04
juvenile dermatomyositis 2.302 1.7e-09
lung adenocarcinoma 1.100 3.0e-02
lung cancer -2.700 6.6e-06
lung carcinoma -2.800 2.1e-09
malignant mesothelioma 2.400 7.6e-07
nasopharyngeal carcinoma 3.000 1.4e-08
non primary Sjogren syndrome sicca 1.400 2.6e-02
pancreatic cancer 1.400 2.8e-03
sarcoidosis 2.400 4.2e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (512)

AA Sequence

MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG      1 - 70
EKRCLNPESKAIKNLLKAVSKERSKRSP                                               71 - 98
//

Text Mined References (519)

PMID Year Title