Property Summary

NCBI Gene PubMed Count 113
PubMed Score 277.65
PubTator Score 393.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

 CSPA Cell Line (3)

Protein-protein Interaction (1)

Gene RIF (83)

PMID Text
25674795 Glycan microarray, flow cytometry, surface plasmon resonance and ELISA analyses reveal that the terminal knob domain of the long fiber (52LFK) binds to CAR, and the knob domain of the short fiber (52SFK) binds to sialylated glycoproteins.
25661872 Combining CAR activation with limited beta-catenin activation induces tumorigenesis, and the tumours share a conserved gene expression signature with beta-catenin-positive human hepatocellular carcinoma.
25605010 Lovastatin enhances adenovirus-mediated TRAIL induced apoptosis by depleting cholesterol of lipid rafts and affecting CAR and death receptor expression of prostate cancer cells.
25497012 Subsequent experiments also proved that both the rno-miR-466d and the human hsa-miR-466, which are orthologs of the miR-467 gene family, could effectively down-regulate the levels of rat and human CAR protein expression, respectively
25459915 CAR might play a role in adipose tissue dysfunction, given its dual associations with adipogenic and inflammatory genes.
25118298 Suggest that distinct forms of CAR play different roles in the undifferentiated state and tight junction formation of human embryos and embryonic stem cells.
24623425 Kinetic analyses show that the apparent first-order rate constant for the inactivation of coxsackievirus B3 by soluble CAR (sCAR) at physiological temperatures varies nonlinearly with sCAR concentration.
24316867 This study shows for the first time that lovastatin reduces the expression of CAR and subsequently the replication of CVB3 in human umbilical vein endothelial cells.
24291282 novel modifier of ventricular conduction and arrhythmia vulnerability in the setting of myocardial ischemia
24096322 CAR regulates epithelial cell junction stability through control of E-cadherin trafficking.
24022195 The expression of CAR was detected in all normal organs, except in the brain. In malignancies, a high degree of variability was notable, ranging from significantly elevated CAR expression to decreased CAR expression.
24015300 CAR belongs to the increasing list of cell surface molecules that undergo ectodomain shedding and that are substrates for -secretase-mediated RIP.
23503462 CAR substantially impacts the growth and survival of oral squamous cell carcinoma cells as a negative regulator of ROCK in vitro and in vivo.
23307165 CAR expression in tumor tissues was significantly higher than that in normal lung tissues. CAR expression had a correlation with the histological grade of lung squamous cell carcinoma.
22914544 study suggests that CXADR and F2RL1 likely play important roles in BP and obesity variation, respectively; and these findings are consistent with those of other studies, so replication and functional analyses are necessary
22809504 CAR and ASIC3 co-immunoprecipitate only when co-expressed with PSD-95.
22708837 Combined fiber modifications both to target alpha(v)beta(6) and detarget the coxsackievirus-adenovirus receptor improve virus toxicity profiles in vivo but fail to improve antitumoral efficacy relative to adenovirus serotype 5.
22190856 Sp1 is involved in regulation of CAR expression.
21850251 Results demonstrate that the increase in E-cadherin mobility is constitutively altered by the presence of CAR at FLCARMCF7 cell junctions.
21843868 Adenoviral drifting motions upstream of internalization are mediated by CAR.
21791114 ZEB1 represses CAR expression in both PANC-1 (pancreatic) and MDA-MB-231 (breast) human cancer cells.
21712047 The mechanism of decreased cell migration, a prerequisite for metastasis and invasion, due to increased CAR expression may be explained by reduced alphavbeta3 integrin expression.
21641134 high mRNA expression of Coxsackie-Adenovirus Receptor may support its role in regeneration of the damaged myocardium rather than having any role in viral mediated heart disease
21468049 CAR facilitates complex effects during colon carcinogenesis: high CAR potentially prevents apoptosis in adenomas, loss of CAR at the plasma membrane promotes growth, dissemination of primary cancers; high membranous CAR may support distant metastases.
21431326 identified a novel splice variant termed CAR4/6 that lacked exon 5 but retained exon 6 encoding the transmembrane domain; CAR4/6 was not expressed in normal cervical tissue but in 42% of CIN2/3 and in most cervical carcinomas
21420451 The authors found that DAF expression allowed attachment of both haemagglutinating and non-haemagglutinating echovirus 6 strains but was not sufficient for promoting echovirus 6 cell entry.
21389059 CAR is a novel estrogen-responsive gene, which is involved in the E(2)-dependent proliferation of breast cancer cells.
20949078 Need for an efficient post-attachment internalisation signal for optimal Adenovirus 5 uptake and transport following surface binding mediated through FX.
20862245 Transduction of brain dopamine neurons by adenoviral vectors is modulated by CAR expression.
20622880 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20361046 apical localization of CAR(Ex8) may be responsible for initiation of respiratory adenoviral infections and this localization appears to be regulated by interactions with PDZ-domain containing proteins
19957088 The induction of expression of CAR by endothelial cells in dilated cardiomyopathy suggests that viruses targeting these receptors could more easily gain entry to heart cells after intravascular administration.
19933937 Inducible expression of coxsackievirus B receptor prevents cardiac dysfunction in acute cardiomyopathy.
19773761 an interaction of CAR and alpha-catenin mediates the impact of CAR on cell proliferation, migration, invasion, and morphology.
19615283 The expression of CAR mRNA and protein in cancer tissue samples are significantly higher than that in the normal and paraneoplastic samples.
19590529 Results suggested that loss of coxsackie and adenovirus receptor in human cancer cell lines under hypoxic conditions occurs in an HIF-1alpha-dependent manner.
19527712 Data show that overexpression of CAR in human epithelial cells leads to increased basal activation of p44/42 MAPK and of beta1 and beta3 integrins, and that this is required for efficient Ad5 infection.
19506548 These data suggest that if the mesenchymal cell phenotype is an accurate measure of an undifferentiated and invasive state, then CAR expression may be more closely aligned with this phenotype of lung cancer cells.
19502044 Observational study of gene-disease association. (HuGE Navigator)
19495568 summarizes recent in vivo studies that relate CAR to heart disease [review]
19467232 ERG1 may loop the distal enhancer PB responsive enhancer module towards the proximal OA response element KI so that together, CAR and HNF4alpha synergistically activate the CYP2B6 promoter.
19142187 Loss of the coxsackie and adenovirus receptor contributes to gastric cancer progression.
19132065 These data do also suggest that CAR does not contribute substantially to carcinogenesis in Barrett's esophagus, however, it may be speculated that loss of CAR promotes tumor progression in advanced stages of Barrett's carcinomas.
19131551 Human erythrocytes bind and inactivate type 5 adenovirus by presenting Coxsackie virus-adenovirus receptor and complement receptor 1.
19119424 presence of CAR on erythrocytes leads to prolonged in vivo blood half-life and significantly reduced liver infection when a CAR-tropic adenoviruse is injected intravenously.
19115936 Complement protein C1q and anti-hexon antibodies together can mediate efficient adenovirus infection in coxsackie and adenovirus receptor-negative cell types.
19100061 Observational study of gene-disease association. (HuGE Navigator)
19007771 CAR stabilizes lymphatic endothelial cell interactions in the skin and may contribute to lymphatic vessel integrity.
18959124 The genes in GENESET 11 together with CAR may play a pathogenic role in the development of dilated cardiomyopathy.
18618240 the association between estrogen receptivity and the expression of hCAR in breast cancer seems to not only reflect a phenotype of low malignancy, but expression of hCAR may also be directly influenced by ER-specific ligands.
18558015 Overexpressiom of coxsackievirus and adenovirus receptor is associted with Endometrial Neoplasms
18552123 The coactivator NCOA6 mediates the mechanism of the synergistic activation of the CYP2C9 gene by CAR and HNF4alpha.
18081225 The data indicated that the five colon cancer cell lines tested expressed CAR and could be efficiently infected by adenoviral vectors.
17896511 The prevalence of CAR expression was significantly higher in viral myocarditis and dilated cardiomyopathy patients than in controls.
17506949 Data show that the overexpression of coxsackie and the adenovirus receptor in T24 bladder cancer cells can inhibit cell growth both in vitro and in vivo.
17494992 Data show that human pancreatic islet endothelial cells express coxsackievirus and adenovirus receptor and are activated by coxsackie B virus infection.
17278108 Soluble CAR isoforms 3/7 and 4/7 may play a pivotal role in ovarian cancer biology.
17210569 CAR may affect cell migration through its interaction with microtubules.
17118917 Compared with Whites, Hispanic donor livers have increased expression of many genes that are transcriptionally regulated by CAR.
17031523 levels of CAR expression observed in cases of squamous cell carcinoma lung cancers, and in cases of small cell lung cancers, and in adenocarcinoma lung cancers
16956941 results identify the binding of adenovirus type 5 (Ad5) fiber with the cellular CAR as a key proinflammatory activation event in epithelial respiratory cells that is independent of the transcription of Ad5 genes
16951199 Genistein combined wwith a histone deacetylase inhibitor can inhibit cancer by altering the transcriptional regulation of CXADR.
16937527 Coxsackievirus-adenovirus receptor does not have a role in 5-FU-related enhancement of adenoviral infection
16923808 determined the crystal structures of canine adenovirus serotype 2 (CAV-2) and the human adenovirus serotype 37 (HAd37) in complex with human CAR D1 at 2.3 and 1.5A resolution, respectively
16831563 molecular model of ligand-binding domain
16284735 data show that CAR expression is significantly increased in breast tumor tissue and increased with increasing grade of tumor
16101391 NMR analysis and secondary structure of domain 2
15958612 Enhanced CAR expression can promote cancer cell survival and data suggest differential expression of CAR as a new factor in tumorigenesis.
15956603 Because the CVB3-specific siRNA is effective against other enteroviruses, siRNAs have potential for a universal anti-enterovirus strategy.
15831949 swine vesicular disease virus isolates from early and recent outbreaks have been compared for their capacity to utilize the progenitor virus receptors coxsackie-adenovirus receptor and decay-accelerating factor
15778494 the entire extracellular domain of CAR is of vital importance to the biology of this highly conserved and important protein
15596863 interacts with a DAF binding Coxsackievirus B3 to induce A-particle formation
15456946 Data suggest that modulating the expression of integrin subunits beta3/5 in human neurons may enhance adenoviral infectivity via the coxsackie-adenovirus receptor.
15364909 Results indicate that the coxsackievirus and adenovirus receptor interacts with multi-PDZ domain protein 1 (MUPP1) and is involved in MUPP1 recruitment to the tight junction.
15304526 CAR interacts with several distinct PDZ-domain-containing proteins and may exert its biological function through these interactions
15173092 expression levels of CAR mRNA varies markedly between different tumor types
14978041 identified 3 CAR isoforms lacking the transmembrane domain and are the result of alternative RNA splicing events between exons IV and VII (CAR4/7), exons III and VII (CAR3/7), and exons II and VII (CAR2/7); CAR4/7 but not CAR2/7 binds to coxsackievirus B3
12920584 Since DAF is abundantly expressed in epithelial and endothelial cells, interaction of cardiotropic Coxsackie Virus B with the DAF coreceptor protein, in addition to CAR, could therefore be advantageous to the virus by enhancing viral entry into the heart.
12021372 palmitylation is important for stable plasma membrane expression and biological activity of CAR but is not critical for adenovirus receptor performance.
11752156 adenovirus serotype 30 fiber does not mediate transduction via the coxsackie-adenovirus receptor
11549277 Additional splice variants discovered; possible result of splicing variants is to influence the efficacy of an adenovirus subgroup C-mediated gene therapy
11479928 Review: Receptor for the group B coxsackieviruses and adenoviruses, CAR

AA Sequence

MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQV      1 - 70
IILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVK     71 - 140
PSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTY    141 - 210
SCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIRED    211 - 280
VPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGA    281 - 350
IPVMIPAQSKDGSIV                                                           351 - 365
//

Text Mined References (124)

PMID Year Title
25674795 2015 Human adenovirus 52 uses sialic acid-containing glycoproteins and the coxsackie and adenovirus receptor for binding to target cells.
25661872 2015 Activating CAR and ?-catenin induces uncontrolled liver growth and tumorigenesis.
25605010 2015 Lovastatin enhances adenovirus-mediated TRAIL induced apoptosis by depleting cholesterol of lipid rafts and affecting CAR and death receptor expression of prostate cancer cells.
25497012 2015 miR-466 is putative negative regulator of Coxsackie virus and Adenovirus Receptor.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25459915 2015 Coxsackie and adenovirus receptor is increased in adipose tissue of obese subjects: a role for adenovirus infection?
25118298 2014 CAR expression in human embryos and hESC illustrates its role in pluripotency and tight junctions.
24623425 2014 Kinetic and structural analysis of coxsackievirus B3 receptor interactions and formation of the A-particle.
24316867 2014 Effect of lovastatin on coxsackievirus B3 infection in human endothelial cells.
24291282 2014 Coxsackie and adenovirus receptor is a modifier of cardiac conduction and arrhythmia vulnerability in the setting of myocardial ischemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24096322 2013 CAR regulates epithelial cell junction stability through control of E-cadherin trafficking.
24022195 2013 Presence of the coxsackievirus and adenovirus receptor (CAR) in human neoplasms: a multitumour array analysis.
24015300 2013 The Coxsackievirus and Adenovirus Receptor (CAR) undergoes ectodomain shedding and regulated intramembrane proteolysis (RIP).
23503462 2014 Coxsackie and adenovirus receptor is a critical regulator for the survival and growth of oral squamous carcinoma cells.
23307165 2013 Expression of the coxsackie and adenovirus receptor in human lung cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22914544 2012 Variants in CXADR and F2RL1 are associated with blood pressure and obesity in African-Americans in regions identified through admixture mapping.
22809504 2012 Coxsackievirus and adenovirus receptor (CAR) mediates trafficking of acid sensing ion channel 3 (ASIC3) via PSD-95.
22708837 2012 Combined fiber modifications both to target ?(v)?(6) and detarget the coxsackievirus-adenovirus receptor improve virus toxicity profiles in vivo but fail to improve antitumoral efficacy relative to adenovirus serotype 5.
22190856 2011 Transcription factor Sp1 is involved in expressional regulation of coxsackie and adenovirus receptor in cancer cells.
22003382 2011 Adenovirus gene transfer to amelogenesis imperfecta ameloblast-like cells.
21850251 2011 CAR modulates E-cadherin dynamics in the presence of adenovirus type 5.
21843868 2011 Drifting motions of the adenovirus receptor CAR and immobile integrins initiate virus uncoating and membrane lytic protein exposure.
21791114 2011 ZEB1 limits adenoviral infectability by transcriptionally repressing the coxsackie virus and adenovirus receptor.
21712047 2011 Increased expression of the coxsackie and adenovirus receptor downregulates ?v?3 and ?v?5 integrin expression and reduces cell adhesion and migration.
21641134 2011 No mutation but high mRNA expression of Coxsackie-Adenovirus Receptor was observed in both dilated and ischemic cardiomyopathy.
21468049 2011 Impact of the coxsackievirus and adenovirus receptor on the adenoma-carcinoma sequence of colon cancer.
21431326 2011 Novel splice variant CAR 4/6 of the coxsackie adenovirus receptor is differentially expressed in cervical carcinogenesis.
21420451 2011 Development of a recombinant CHO cell model for the investigation of CAR and DAF role during early steps of echovirus 6 infection.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21389059 2011 Coxsackie and adenovirus receptor is a target and a mediator of estrogen action in breast cancer.
20949078 2010 Requirements for receptor engagement during infection by adenovirus complexed with blood coagulation factor X.
20862245 2010 Transduction of brain dopamine neurons by adenoviral vectors is modulated by CAR expression: rationale for tropism modified vectors in PD gene therapy.
20622880 2010 Genome-wide association study identifies a susceptibility locus at 21q21 for ventricular fibrillation in acute myocardial infarction.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20361046 2010 Isoform-specific regulation and localization of the coxsackie and adenovirus receptor in human airway epithelia.
20235596 2010 Adenoviral transduction of enterocytes and M-cells using in vitro models based on Caco-2 cells: the coxsackievirus and adenovirus receptor (CAR) mediates both apical and basolateral transduction.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19957088 2010 Dilated cardiomyopathy alters the expression patterns of CAR and other adenoviral receptors in human heart.
19933937 2009 Prevention of cardiac dysfunction in acute coxsackievirus B3 cardiomyopathy by inducible expression of a soluble coxsackievirus-adenovirus receptor.
19925382 2009 Characterization of the porcine constitutive androstane receptor (CAR) and its splice variants.
19773761 2009 Loss of Coxsackie and adenovirus receptor downregulates alpha-catenin expression.
19615283 2009 [Expression of coxsackievirus and adenovirus receptor in non-small cell lung cancer and its significance].
19590529 2010 Downregulation of the coxsackie and adenovirus receptor in cancer cells by hypoxia depends on HIF-1alpha.
19527712 2009 Coxsackie adenovirus receptor (CAR) regulates integrin function through activation of p44/42 MAPK.
19506548 2009 CAR mediates efficient tumor engraftment of mesenchymal type lung cancer cells.
19502044 2009 Role of genetic susceptibility to latent adenoviral infection and decreased lung function.
19495568 2009 CAR-diology--a virus receptor in the healthy and diseased heart.
19467232 2009 Early growth response 1 loops the CYP2B6 promoter for synergistic activation by the distal and proximal nuclear receptors CAR and HNF4alpha.
19142187 2009 Loss of the coxsackie and adenovirus receptor contributes to gastric cancer progression.
19132065 2009 Expression and function of the coxsackie and adenovirus receptor in Barrett's esophagus and associated neoplasia.
19131551 2009 Human erythrocytes bind and inactivate type 5 adenovirus by presenting Coxsackie virus-adenovirus receptor and complement receptor 1.
19119424 2009 The cell adhesion molecule "CAR" and sialic acid on human erythrocytes influence adenovirus in vivo biodistribution.
19115936 2008 Complement component C1q and anti-hexon antibody mediate adenovirus infection of a CAR-negative cell line.
19100061 2008 [Analysis of heterogeneity in exon 4 of Coxsackievirus and Adenovirus receptor gene in dilated cardiomyopathy].
19064666 2008 JAM-L-mediated leukocyte adhesion to endothelial cells is regulated in cis by alpha4beta1 integrin activation.
19007771 2009 Coxsackie- and adenovirus receptor (CAR) is expressed in lymphatic vessels in human skin and affects lymphatic endothelial cell function in vitro.
18959124 2008 Role of coxsackievirus and adenovirus receptor in the pathogenesis of dilated cardiomyopathy and its influencing factor.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18636119 2008 Coxsackievirus and adenovirus receptor (CAR) mediates atrioventricular-node function and connexin 45 localization in the murine heart.
18618240 2009 Expression of coxsackie-adenovirus receptor is related to estrogen sensitivity in breast cancer.
18558015 2008 Coxsackievirus and adenovirus receptor expression in human endometrial adenocarcinoma: possible clinical implications.
18552123 2008 Nuclear receptor coactivator 6 mediates the synergistic activation of human cytochrome P-450 2C9 by the constitutive androstane receptor and hepatic nuclear factor-4alpha.
18081225 2007 Analysis of the expression of coxsackievirus and adenovirus receptor in five colon cancer cell lines.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17896511 2007 [The expression of coxsackie B virus adenovirus receptor (CAR) in viral myocarditis and dilated cardiomyopathy patients].
17675666 2007 Podocin participates in the assembly of tight junctions between foot processes in nephrotic podocytes.
17538635 2007 Positive and negative regulation of adenovirus infection by CAR-like soluble protein, CLSP.
17506949 2007 Overexpression of coxsackie and adenovirus receptor inhibit growth of human bladder cancer cell in vitro and in vivo.
17494992 2007 Human pancreatic islet endothelial cells express coxsackievirus and adenovirus receptor and are activated by coxsackie B virus infection.
17278108 2007 Soluble isoforms but not the transmembrane form of coxsackie-adenovirus receptor are of clinical relevance in epithelial ovarian cancer.
17210569 2007 The Coxsackie and adenovirus receptor binds microtubules and plays a role in cell migration.
17118917 ADME transcriptome in Hispanic versus White donor livers: evidence of a globally enhanced NR1I3 (CAR, constitutive androstane receptor) gene signature in Hispanics.
17031523 2006 Coxsackievirus and adenovirus receptor expression in non-malignant lung tissues and clinical lung cancers.
16956941 2006 Interaction of adenovirus type 5 fiber with the coxsackievirus and adenovirus receptor activates inflammatory response in human respiratory cells.
16951199 2006 Mechanism of increased coxsackie and adenovirus receptor gene expression and adenovirus uptake by phytoestrogen and histone deacetylase inhibitor in human bladder cancer cells and the potential clinical application.
16937527 2006 5-Fluorouracil-related enhancement of adenoviral infection is Coxsackievirus-adenovirus receptor independent and associated with morphological changes in lipid membranes.
16923808 2006 Structural and mutational analysis of human Ad37 and canine adenovirus 2 fiber heads in complex with the D1 domain of coxsackie and adenovirus receptor.
16831563 2007 Comparison of homology models and X-ray structures of the nuclear receptor CAR: assessing the structural basis of constitutive activity.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16284735 2005 The Coxsackie-adenovirus receptor has elevated expression in human breast cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16101391 2005 NMR assignment and secondary structure of the Coxsackievirus and Adenovirus receptor domain 2.
15958612 2005 Coxsackie and adenovirus receptor promotes adenocarcinoma cell survival and is expressionally activated after transition from preneoplastic precursor lesions to invasive adenocarcinomas.
15956603 2005 A small interfering RNA targeting coxsackievirus B3 protects permissive HeLa cells from viral challenge.
15831949 2005 More recent swine vesicular disease virus isolates retain binding to coxsackie-adenovirus receptor, but have lost the ability to bind human decay-accelerating factor (CD55).
15800062 2005 Neutrophil migration across tight junctions is mediated by adhesive interactions between epithelial coxsackie and adenovirus receptor and a junctional adhesion molecule-like protein on neutrophils.
15778494 2005 The role of the extracellular domain in the biology of the coxsackievirus and adenovirus receptor.
15596863 2005 Interaction with coxsackievirus and adenovirus receptor, but not with decay-accelerating factor (DAF), induces A-particle formation in a DAF-binding coxsackievirus B3 isolate.
15533241 2004 Isoform-specific expression of the Coxsackie and adenovirus receptor (CAR) in neuromuscular junction and cardiac intercalated discs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456946 2004 Characterization of the expression of key adenoviral receptors CAR and integrin beta3/beta5 subunits on the membrane of human NT2 neurons.
15364909 2004 The coxsackievirus and adenovirus receptor interacts with the multi-PDZ domain protein-1 (MUPP-1) within the tight junction.
15304526 2004 A role for the PDZ-binding domain of the coxsackie B virus and adenovirus receptor (CAR) in cell adhesion and growth.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15173092 2004 High-level expression of the coxsackievirus and adenovirus receptor messenger RNA in osteosarcoma, Ewing's sarcoma, and benign neurogenic tumors among musculoskeletal tumors.
14978041 2004 Alternatively spliced soluble coxsackie-adenovirus receptors inhibit coxsackievirus infection.
14967025 2004 Solution structure of the coxsackievirus and adenovirus receptor domain 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12920584 2004 Virus-receptor interactions of coxsackie B viruses and their putative influence on cardiotropism.
12869515 2003 JAML, a novel protein with characteristics of a junctional adhesion molecule, is induced during differentiation of myeloid leukemia cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12468544 2003 The Coxsackievirus and adenovirus receptor (CAR) forms a complex with the PDZ domain-containing protein ligand-of-numb protein-X (LNX).
12297051 2002 Adenovirus fiber disrupts CAR-mediated intercellular adhesion allowing virus escape.
12021372 2002 Fatty acid modification of the coxsackievirus and adenovirus receptor.
11734628 2001 The coxsackievirus and adenovirus receptor is a transmembrane component of the tight junction.
11573093 2001 Interaction of coxsackievirus B3 with the full length coxsackievirus-adenovirus receptor.
11549277 2001 Identification of alternative splice products encoded by the human coxsackie-adenovirus receptor gene.
11479928 Receptor for the group B coxsackieviruses and adenoviruses: CAR.
11457744 2001 Human coxsackie-adenovirus receptor is colocalized with integrins alpha(v)beta(3) and alpha(v)beta(5) on the cardiomyocyte sarcolemma and upregulated in dilated cardiomyopathy: implications for cardiotropic viral infections.
11316797 2001 Multiple regions within the coxsackievirus and adenovirus receptor cytoplasmic domain are required for basolateral sorting.
11080637 2000 Dimeric structure of the coxsackievirus and adenovirus receptor D1 domain at 1.7 A resolution.
10830953 2000 The DNA sequence of human chromosome 21.
10814575 2000 The coxsackie-adenovirus receptor (CAR) is used by reference strains and clinical isolates representing all six serotypes of coxsackievirus group B and by swine vesicular disease virus.
10666333 2000 Expression of the adenovirus receptor and its interaction with the fiber knob.
10567268 1999 Structural analysis of the mechanism of adenovirus binding to its human cellular receptor, CAR.
10543405 1999 Genomic organization and chromosomal localization of the human Coxsackievirus B-adenovirus receptor gene.
10490761 1999 Expression of coxsackie adenovirus receptor and alphav-integrin does not correlate with adenovector targeting in vivo indicating anatomical vector barriers.
9733828 1998 The coxsackievirus-adenovirus receptor protein can function as a cellular attachment protein for adenovirus serotypes from subgroups A, C, D, E, and F.
9420240 1998 The murine CAR homolog is a receptor for coxsackie B viruses and adenoviruses.
9144533 1997 Purification of the putative coxsackievirus B receptor from HeLa cells.
9096397 1997 HCAR and MCAR: the human and mouse cellular receptors for subgroup C adenoviruses and group B coxsackieviruses.
9036860 1997 Isolation of a common receptor for Coxsackie B viruses and adenoviruses 2 and 5.