Property Summary

NCBI Gene PubMed Count 221
PubMed Score 588.62
PubTator Score 373.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
urothelial carcinoma -1.900 6.8e-03
glioblastoma -1.400 8.8e-03
sonic hedgehog group medulloblastoma -3.200 8.1e-06
atypical teratoid / rhabdoid tumor -2.200 2.2e-04
medulloblastoma, large-cell -3.600 4.9e-05
primitive neuroectodermal tumor -1.700 8.5e-03
intraductal papillary-mucinous adenoma (... -1.400 1.1e-05
lung cancer -2.200 2.7e-05
breast carcinoma -2.200 8.8e-29
adult high grade glioma -1.600 4.2e-03
posterior fossa group B ependymoma -2.000 2.3e-07
lung adenocarcinoma -1.300 1.9e-03
invasive ductal carcinoma -1.374 6.9e-03
non-inflammatory breast cancer -3.600 6.8e-03
lung carcinoma -1.200 6.6e-07
ovarian cancer 1.600 1.3e-04

Protein-protein Interaction (1)

Gene RIF (211)

PMID Text
26796342 Cell proliferation enhancing and anti-apoptosis activity requires the intracellular domain and apparently the dimerization of the transmembrane chemokine ligand.
26718770 CX3CL1 increased the migration and invasiveness of DU145 and PC-3, causing epithelial-to-mesenchymal transition. TACE/TGF-alpha/EGFR pathway activation and Slug upregulation were responsible for this.
26633537 CX3CL1 was expressed only by the normal and cancer adjacent normal fallopian tube epithelium; its expression was largely lost in the malignant fallopian epithelium.
26632602 Suggest that CX3CL1 participates in cross-talk mechanisms between endothelium and other muscle tissue cells and may promote a shift in the microenvironment toward a more regenerative milieu after exercise.
26586708 Skin and serum CX3CL1 elevated expression was associated with psoriasis severity.
26558776 Fractalkine signaling regulates macrophage recruitment into the cochlea and promotes survival of spiral ganglion neurons.
26496926 FKN enhances cell proliferation by promoting cell cycle progression in hypoxic prostate cancer cells.
26191329 The interactions of CX3CL1, LEPR and IL-6 genes might increase the risk of coronary artery disease in Chinese Han population.
26168217 data suggest that fractalkine contributes to lymphocyte shifts, which may influence development of MVO through the action of effector T cells.
26080445 Data show that US28 receptor binds with high selectivity and improved binding for the CX3C chemokine, CX3CL1.
26074318 MIP-1beta, TNF-alpha and fractalkine are expressed in plasma, which reflects the levels of several pro-atherogenic cytokines in plaque tissue
26049921 Report increased circulating fractalkine in STEMI patients, which was rapidly decreased after PCI.
25962684 the results from the present study support the concept of the CX3CL1-mediated activation of the progression of the multiple myeloma via CX3CR1.
25845619 CX3CL1 and CX3CR1 may contribute to the formation of coronary atherosclerotic plaque in coronary artery disease
25795074 In a CKD cohort, CX3CL1 levels were associated positively with several CVD risk factors and metabolic traits, lower estimated glomerular filtration rate, and higher levels of inflammatory cytokines, as well as prevalent CVD and diabetes.
25769431 we suggest that increased maternal TNF-alpha may up-regulate the expression and release of placental fractalkine, which, in turn, may contribute to an exaggerated systemic inflammatory response in preeclampsia
25745166 this study reports the crystal structure at 2.9 angstrom resolution of the human cytomegalovirus GPCR US28 in complex with the chemokine domain of human CX3CL1 (fractalkine).
25692263 Fractalkine in synovial fluid and serum is reflective of symptomatic severity in knee osteoarthritis.
25596843 This study found that CX3CL1 and TREM2, two genes related to neuroinflammation, were expressed at higher levels in brain regions with pronounced vulnerability to Alzheimer disease-related changes.
25596452 CX3CL1 induces recruitment of CX3CR1(+)ICAM-1(+)CD4(+) T-cells into the central nervous system (CNS) during the early inflammatory response in multiple sclerosis.
25566740 Forskolin-induced differentiation and syncytialization of the trophoblast cell line BeWo was accompanied with a substantial upregulation in fractalkine expression and led to increased adhesion of the monocyte cell line THP-1, which bound to syncytia.
25503251 The study found no difference in plasma levels of CX3CL1 and CCL2 among age-related macular degeneration patients and the control groups.
25480631 The findings of elevated serum Fkn and Fkn gene expression in both vaso-occlusive crisis and stable forms of SCD suggest that this chemokine may be involved in the pathogenesis of inflammation observed in SCD.
25420917 These findings strongly suggest the implication of the CX3CL1/CX3CR1 axis in the pathogenesis of aGVHD.
25359863 CX3CL1, but not other chemokines tested, promoted monocyte survival in a dose-dependent manner with full-length CX3CL1 (including the mucin stalk) having a more potent antiapoptotic effect than chemokine-domain CX3CL1.
25320221 Fractalkine and CX3CR1 may play a role in the pathogenesis of pSS, including extraglandular manifestations.
25253723 Data indicate that metalloprotease ADAM10 has limited interaction with CX3CL1 chemokine on the surface of umbilical vein endothelial cell.
25040843 molecular cloning and expression analysis of fractalkine (Fk); findings indicate NF-kappaB and STAT1/STAT3 contribute to Fk promoter activity in smooth muscle cells, and that this takes place through functional NF-kappaB and interferon-gamma-activated sites
24935307 Measuring serum levels of fractalkine, IP-10, and their receptors (especially the fractalkine/IP-10 combination) may serve as a noninvasive approach for the early diagnosis of renal allograft rejection
24930044 Fractalkine levels are elevated the first 12 h after percutaneous coronary intervention in patients with acute myocardial infarction, however, not correlated to infarct size.
24862326 HIV-1 Tat-mediated downregulation of CX3CR1 inhibits CX3CL1-induced migration of microglia
24789099 Data show that chemokine domain of fractalkine (FKN-CD) can activate alphavbeta3 integrin in the absence of fractalkine receptor CX3CR1, but that this activation requires the direct binding of FKN-CD to alphavbeta3.
24788416 Insulin resistance increases plaque vulnerability by augmenting the CX3CL1/CX3CR1 axis, which is mechanistically linked to reduced vascular smooth muscle cell survival
24764683 CX3CL1/CX3CR1 expression may be associated with the occurrence and development of gastric carcinoma as well as gastric carcinoma perineural invasion
24676787 Low expression of CX3CL1 is gender-specifically associated with soft tissue sarcoma.
24673545 Data suggest that serum levels of fractalkine are not different between women with gestational diabetes and control subjects, but are associated with markers of insulin resistance and progranulin in normal pregnancy.
24632971 A significant and persistent decrease in circulating fractalkine was observed after orthopedic and coronary bypass surgery despite a marked inflammatory response.
24603149 CX3CL1(+) apo-MPs released by apoptotic cells mediate the chemotactic transmigration of alveolar macrophages.
24427339 higher levels of FKN secreted by eutopic endometrial stromal cells facilitate the onset and progression of endometriosis
24352739 Results show that FKN appears to prevent excess microglial activation in the absence of injury while promoting activation of microglia and astrocytes during inflammatory episodes.
24336891 elevated plasma levels promote platelet hyperreactivity and vascular dysfunction in congestive heart failure
24324211 Increased serum levels of CX3CL1 protein were observed in Sjogren's patients and in RA patients compared with controls, but no difference was found between Sicca patients and controls. mRNA was upregulated in Sjogren's patients' salivary glands.
24307760 Unlike IL-18 and FKN, plasma GZB may have a role in severity of acute coronary syndrome
24294368 miR-195 plays important roles in regulating the functions of endometrial stromal cells by targeting fractalkine.
24270813 The modulatory influence of TNFalpha on CX3CR1 expression in hypoxia and CX3CL1/CX3CR1 interaction may serve as a compensatory mechanism to preserve or augment the pro-inflammatory course of intercellular interactions in placental endothelium
24185682 CX3CL1 produced by senescent biliary epithelial cells may promote infiltration of corresponding CX3CR1-expressing cells and further aggravate inflammation in bile duct lesion in primary biliary cirrhosis.
24147028 HIV-1 Tat-mediated downregulation of CX3CR1 inhibits CX3CL1-induced migration of microglia
24068281 These observations suggest a crosstalk between monocytes and human renal mesangial cells via the interaction of MMP2 and fractalkine.
24060055 This study identified for the first time that increases in CX3CL1 and CX3CR1-expressing cells are significantly related to ligamentum flavum hypertrophy.
24006262 we show that deletion of the CX3CL1 receptor in Cx3cr1(-/-) DCs results in markedly delayed lymphatic trafficking in vivo and impaired translymphatic migration in vitro.
23974513 studies support an important pathogenic role of CX3CL1/CX3CR1 in atherogenesis and plaque destabilization
23956503 CX3CL1 and CX3CR1 signaling may have a role in the pathomechanism of placental microvasculature remodeling in diabetes class C
23912959 CX3CL1 expression is associated with poor outcome in breast cancer patients.
23897050 Our results provide new understanding of the role of ADAM-17, p38 MAPK, cathepsins, and the proteasome pathway in FKN expression and shedding.
23887641 The CX3CR1 antagonist F1 (N-terminal modified CX3CL1) is a potent inhibitor of the progression of atherosclerotic lesions.
23857671 CX3CL1/CX3CR1 reprograms glucose metabolism through HIF-1 pathway in pancreatic cancer cells.
23724129 HDACs and NF-kB signaling coordinate epithelial expression of CX3CL1 to promote mucosal antimicrobial defense through suppression of the mir-424-503 gene.
23645563 CXCL12 and CX3CL1 and their respective receptors are expressed in benign and malignant human nerve sheath tumors
23584220 Fractalkine and its receptor CX3CR1 are expressed in the human brain after traumatic brain injury and intracranial hemorrhage and may be involved in the limitation of tissue damage.
23477808 fat mass alone is not responsible for elevation of fractalkine seen in obese individuals
23470165 Interactions between CX3CL1 and CX3CR1 may contribute to the development of leukocytoclastic vasculitis.
23332170 Soluble fractalkine overexpression significantly reduced tau pathology in transgenic mouse model of tauopathy.
23303826 In contrast to CX3CR1, which promotes efficient cell capture upon binding to anchored CX3CL1, US28 acts to increase the migration of cells upon binding to the same ligand.
23261412 Results suggest that putative genetic factors (heritability) explained 43.6+/-3% of the total variation of plasma fractalkine (CX3CL1) levels.
23229614 CX3CL1 was found to be abundantly expressed in human meningioma samples of different malignant grades.
23168573 The TLR3/IRF3/Fkn signaling pathway may, at least in part, mediate immune and inflammatory responses against viral infection in mesangial cells.
23125415 Chemokine fractalkine receptor (CX3CL1) binds directly to integrins alpha4beta1 and alphav4beta3 at a very high affinity.
23117657 Suggest that Ang-II induces functional CX(3)CL1 expression in arterial but not in venous endothelial cells.
23086480 resistin contributes to the pro-inflammatory state of SMC by the up-regulation of CX3CL1 and CX3CR1 expression via a mechanism involving NF-kB, AP-1, and STAT1/3 transcription factors, (2) resistin employs TLR4 and Gi-protein signaling.
23029290 Fibroblast growth factor receptor 1 activation leads to induction of CX3CL1 in a tumor setting.
23014777 Fractalkine was a significant predictor of all-cause mortality in patients with advanced heart failure. Fractalkine improves risk prediction beyond NT-proBNP and might therefore help to identify high risk patients who need special care.
23002075 Hypoxic release of endothelial CX3CL1 induced SMC phenotypic switching from the contractile to the proliferative state. Inhibition of CX3CR1 prevented CX3CL1 stimulation of SMC proliferation and monolayer expansion.
22916279 Fractalkine is expressed in early and advanced atherosclerotic lesions and supports monocyte recruitment via CX3CR1.
22897138 In the present coronary artery disease population, no differences in circulating levels of fractalkine or expression levels of CX3CR1 were observed between patients with and without T2DM, or with and without metabolic syndrome.
22798324 In contrast to our original hypothesis, lower concentrations of CX3CL1 are associated with worse stroke outcome
22739755 Fractalkine is a potential local inflammatory mediator which influences platelet activation in the setting of atherosclerosis. Review.
22709495 FKN up-regulates FKN mRNA expression in rheumatoid arthritis-fibroblast-like synoviocytes via the NF-kappaB pathway to stimulate cell proliferation.
22692452 CX3CL1 expression in the conjunctiva is increased in immune cell trafficking during toxic ocular surface inflammation.
22664781 MCP-1, RANTES and fractalkine independently participate in the pathogenesis of plaque vulnerability and subsequent plaque rupture.
22652599 increased fractalkine levels are associated with decreased endogenous platelet inhibition and impaired response to P2Y12 inhibition with clopidogrel.
22641052 ADAM-10 is responsible for TNF-induced shedding of fractalkine from the cell membrane in human adult brain endothelial cell line.
22639377 Overall survival was worse for patients with pancreatic ductal adenocarcinoma with the combined high expression of CX3CL1 and CX3CR1. Patients with a high CX3CL1 expression tumor had a significantly shorter overall survival.
22572859 Upregulation of glomerular and urinary fractalkine suggests an involvement of the CX3CR1-fractalkine axis in the exacerbation of gross hematuria in patients with IgA nephropathy.
22422195 CX3CL1 is a new prognostic biomarker and may be a novel candidate for development of a more effective therapeutic strategy for breast carcinoma.
22394569 Serum CX3CL1 level could be a surrogate marker of polymyositis and dermatomyositis activity.
22322207 The serum CX3CL1 level may be used as a clinical marker to assess the disease activity of adult-onset Still's disease.
22321225 Upregulated MCP-1, RANTES and Fractalkine might promote coronary plaque vulnerability in unstable angina pectoris patients.
22177089 Serum CX3CL1 levels are not changed in this study of active and inactive Behcet's disease and neuro-Behcet's disease.
22123179 Data show that CX(3)CR1 expression enables CD4(+)CD28(-) T cells to migrate towards a fractalkine gradient in vitro.
22093090 HIV-1 Tat-mediated downregulation of CX3CR1 inhibits CX3CL1-induced migration of microglia
21768350 Data show that Pic, a class 2 SPATE protein produced by Shigella flexneri 2a targets a broad range of human leukocyte glycoproteins including CD43, CD44, CD45, CD93, CD162 and the surface-attached chemokine fractalkine.
21750716 Data show that together with GILZ, chemokine CX3CL1 emerges as a regulator of cell proliferation, which may be of potential
21638128 is associated with Henoch-Schonlein purpura
21546901 CX(3)CR1/CX(3)CL1 system may contribute to interactions between chronic lymphocytic leukemia (CLL) cells and tumor microenvironment by increasing CXCL12-mediated attraction of leukemic cells to nurselike cells
21527754 Suggest that amyloid-beta enhances endothelial progenitor cell migration in response to fractalkine through the upregulation of CX3CR1. This may be involved in the development of choroidal neovascularization.
21525510 CX3CL1-CX3CR1 is a novel inflammatory adipose chemokine system that modulates monocyte adhesion to adipocytes and is associated with obesity, insulin resistance, and type 2 diabetes.
21463954 plasma fractalkine (CX3CL1) may have a role in severe liver disease in HIV/HCV co-infected patients with HCV genotype 1
21398580 endothelial expressed fractalkine activates platelets via its cognate receptor CX3CR1, whereas platelet adhesion is predominantly mediated by GPIbalpha and independent of CX3CR1
21168500 Fractalkine and IL-5 inhibit cytokine-induced proinflammatory gene expression in a human microglia cell line
20922190 Soluble fractalkine is up-regulated under inflammatory conditions associated with hepatocellular carcinoma development, but ADAM17 does not appear to be responsible for regulating this process.
20880200 CX3CL1 secreted by oral fibroblasts appears to play an important role in the oral immune response to Candida albicans infection
20869263 FKN levels significantly correlate with preoperative hypoxemia and PAH, suggesting that FKN may be up-regulated during hypoxemia
20668227 Inhibition of Natural killer cell response to CX3CL1 is mediated by the P2Y11 receptor.
20664972 Suggest that fractalkine may play a key role in the mechanism of angiogenesis and carcinogenesis of hepatocellular carcinoma.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20559678 Data suggest that transmembrane CX3CL1 mediates leukocyte transmigration via the DRY motif and C-terminus of CX3CR1 and the activity of ADAM10.
20512991 A novel combination of surface molecules, including VAP-1 and CX(3)CL1 promotes the recruitment of CD16(+) monocytes to the liver, allowing them to localize at sites of chronic inflammation and fibrosis.
20511186 CX3CL1 is expressed on the tumor cell plasma membrane while soluble CX3CL1 accumulates in the culture supernatants, indicating that the chemokine is constitutively released.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20482449 Data show that pre-CPB, plasma levels of EGF and MIP-1beta, 2 h following CPB, sVCAM-1, fractalkine and MIP-1ALPHA, and at later time points, sVCAM-1 and IL-6 were associated with AKI.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20237149 Thromboxane receptor stimulation induces rapid cleavage of surface CX(3)CL1, thereby releasing the soluble chemoattractant, plus mobilization of the remaining transmembrane CX(3)CL1 to enhance the avidity of interactions with adherent leukocytes.
20158572 Data show that PLT adhesion to HIMEC was ICAM-1, FKN and integrin alpha(v)beta(3) dependent.
20041188 Germinal centre and memory B cells expressed CX(3)CR1 but only germinal centre B cells were attracted by soluble CX(3)CL1 in a transwell assay.
20034466 resistin and high glucose induce the up-regulation of P-selectin and fractalkine and the ensuing increased monocyte adhesion by a mechanism involving oxidative stress and NF-kB and AP-1 activation.
20019415 Increases in the fractalkine level and the number of CX3CR1-expressing mononuclear cells might contribute to coronary plaque rupture in unstable angina pectoris.
19923448 CX3CL1/fractalkine, which is a dual functional chemokine, on osteoblasts works as an adhesion molecule toward osteoclast precursors. Osteoblasts constitutively express CX3CL1 at high levels and may also use soluble CX3CL1 to attract osteoclast precursors.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851523 Patients with insulin-dependent diabetes or coronary heart disease following rehabilitation express serum fractalkine levels similar to those in healthy control subjects.
19850645 These data suggest that PPARgamma activation represses FKN signaling.
19840952 two novel and important functions of CX3CL1 on primary human vascular smooth muscles: anti-apoptosis and proliferation, both mediated via epiregulin-induced EGFR signalling
19729601 Observational study of gene-disease association. (HuGE Navigator)
19723636 the cytoplasmic tail of CX(3)CL1 facilitates its constitutive clathrin-mediated endocytosis. Such regulation enables intracellular storage of a sizable pool of presynthesized CX(3)CL1
19605482 the carboxy terminus of US28 controls US28 signaling in the context of HCMV infection and chemokines such as CX3CL1 can decrease constitutive US28 signals and yet simultaneously promote nonconstitutive US28 signals
19563789 The expression of human fractalkine is significantly increased following bone marrow transplantation into the ischemic brain.
19432809 ADAM10, ADAM17 and MMP-2 synthesized by activated hepatic stellate cells mediate CX3CL1 shedding and release of chemotactic peptides.
19372452 we found no replicable associations of CX3CL1 polymorphisms with carotid intima-media thickness or plaque
19372452 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19369458 Our results suggest that the CX3CL1-CX3CR1 system in patients with active rheumatoid arthritis may be sensitive to anti-tumor necrosis factor-alpha therapy, and confirm that CX3CL1 plays a crucial role in the pathogenesis of rheumatoid arthritis.
19351602 The new data uncover fractalkine (Fk) as a novel molecular link between resistin and inflammation and show that resistin and TNF-alpha have no additive effect in Fk up-regulation or on the signalling molecules implicated
19327232 Serum CX3CL1 (chemokine (C-X3-C motif) ligand 1)levels were significantly higher in Microscopic polyangiitis patients than in either Large Vessel vasculitis group or healthy individuals
19324423 Tumour necrosis factor (TNF) significantly increased fractalkine mRNA (>100 fold) and protein expression, which was associated with increased shedding of fractalkine from the cell.
19214751 the suppression of CX3CL1 production by WIN55,212-2 involves inhibition of signaling via p38 MAPK.
19155311 Prostate cancer cell chemotaxis seems, at least partially, dependent on membrane-bound CX3CL1/fractalkine ligand for chemokine receptor CX3CR1.
19153557 in chronic pancreatitis patients, pancreatic fractalkine expression appears to be linked to visceral pain and to the recruitment of inflammatory cells into the pancreatic tissue and nerve fibers, with subsequent pancreatic neuritis
19132243 High glucose conditions induce upregulation of fractalkine and monocyte chemotactic protein-1 in human smooth muscle cells.
19047106 CX3CL1, IL-15, and CCL4 can serve as independent predictors of biochemical recurrence.
19030200 Fractalkine and TGF-beta1 levels reflect the severity of chronic pancreatitis in humans.
18938112 Increased CX3CL1/CX3CR1 interaction could contribute to the inflammatory phenotype seen in subgroups of CVID patients.
18800027 urinary fractalkine levels predict acute rejection, where high levels were associated with steroid-resistance and poor outcome.
18799722 CX3CL1/fractalkine is released rapidly from apoptotic lymphocytes, via caspase- and Bcl-2-regulated mechanisms, to attract macrophages.
18799080 In systemic sclerosis, serum fractalkine basal level was significantly higher than in controls
18778890 CX3CR1-expressing neuroblastoma cells were stimulated by CX3CL1 to transmigrate through human bone-marrow endothelial cells
18725411 analysis of the role of the transmembrane domain and how it affects the adhesiveness of the CX3CL1 chemokine, which requires its aggregation
18606701 in response to Shiga toxin 2, FKN is induced playing an essential role in the promotion of leukocyte-endothelial cell interaction.
18523306 Transduction of adhesion molecules in unactivated human dermal microvascular cells indicates that T cell receptor-driven transedothelial migration is dependent upon fractalkine.
18436581 The thrombin-induced monocyte/endothelial cell cross-talk mediated by increased CX3CL1 expression potentiates the CCL2 chemokine generation that might contribute to the recruitment of monocytes into inflamed areas
18367676 CX3CL1 is involved in mechanisms by which trophoblast cells migrate during early pregnancy.
18296082 CX3CL1+ and CX3CR1+ cells are present in abdominal aortic aneurysms and may contribute to the recruitment of inflammatory cells.
18230685 CX(3)CL1 expression is regulated through the NF-kappaB pathway; dexamethasone inhibits CX(3)CL1 expression through a glucocorticoid receptor-dependent (RU486 sensitive) mechanism
18006432 Activation of fractalkine/CX3CR1 by vascular endothelial cells induces angiogenesis through VEGF-A/KDR.
17907166 These data assign a critical role to fractalkine and its receptor in fibroblast proliferation and pannus formation in rheumatoid arthritis
17895402 fractalkine-CX(3)CR1 interaction resulting in recruitment of natural killer (NK) cells and monocyte-macrophages plays an important role in mediating endothelial damage in cytomegalovirus infection
17885215 s-FKN is shed from endothelial cells following hypoxia/reoxygenation and acts on them through CX3CR1 to increase ICAM-1 expression and promote neutrophil adhesion through activation of the Jak-Stat5 pathway
17611763 Observational study of gene-disease association. (HuGE Navigator)
17611763 Plasma levels of CX3CL1 do not seem to be a useful tumour marker that reflects the disease outcome of CRC.
17505143 Observational study of gene-disease association. (HuGE Navigator)
17487393 This study further confirms that membrane-expressed fractalkine plays a critical role in NK cell activation.
17471309 FKN might preferentially mediate migration and recruitment of CD16+ monocytes, and might contribute to synovial tissue inflammation.
17415055 Observational study of gene-disease association. (HuGE Navigator)
17241867 significant role of FKN in disease pathogenesis of inflammatory bowel diseases
17151939 HIV-1 Tat-mediated downregulation of CX3CR1 inhibits CX3CL1-induced migration of microglia
17132725 interaction of CX(3)CR1(+) cells with fractalkine present on activated endothelial cells may contribute to renal injury in hemolytic uremic syndrome
17082482 In addition to its role as a chemokine and adhesion molecule, fractalkine induces vascular dysfunction by stimulating vascular reactive oxygen species resulting in reduced NO bioavailability
17075825 Fkn and CX(3)CR1 play crucial roles in the pathogenesis of rheumatoid vasculitis
17062081 serum CXC3L1 is increased in pityriasis rosea
17002687 Observational study of gene-disease association. (HuGE Navigator)
17002687 role for the CX3CL1-CX3CR1 system in the pathogenesis of psoriasis
16877565 This study suggests that FKN may play an important role in the pathophysiological process of inflammatory angiogenesis.
16767549 This review examines new concepts underlying fractalkine-mediated leukocyte migration and tissue damage, focusing primarily on the pathophysiological roles of fractalkine in rheumatic diseases
16645504 study demonstrates a significant association between the CX3CR1-T280M polymorphism and severe respiratory syncytial virus -induced bronchiolitis
16224053 CX3CL1/CX3CR1 dyad may contribute to atherogenesis and plaque destabilization in human coronary artery disease
15774461 dynamic, SNARE-mediated recycling of CX(3)CL1 from the cell surface to and from an endomembrane storage compartment
15726664 Fractalkine and CX3CR1 are involved in the recruitment of intraepithelial lymphocytes of intrahepatic bile ducts.
15621116 trend toward higher glomerular Fractalkine expression among patients with more severe kidney transplantation rejection
15579768 examined production and localization of fractalkine in endometrium at different stages of the menstrual cycle corresponding to known leukocyte accumulation, in early pregnancy and in women using progestin-only contraceptives
15529011 Fractalkine-CX3CR1 protein system may be involved in the inflammatory response to traumatic brain injury
15361546 Replacement of the fractalkine N terminus with the cognate domain of vMIP-II disrupted the ability of FKN to bind CX3CR1.
15223613 Higher serum levels in moderate-severe depression
15131578 fractalkine (FKN) and CX(3)CR1 expression in the skin, serum sFKN levels, and CX(3)CR1 expression on blood leukocytes in patients with atopic dermatitis
15111313 fractalkine expression is induced by TNFalpha in arterial endothelial cells
15013759 IL-4 and TNF-alpha induced expression of fractalkine in fibroblasts, and subsequent monocyte chemotactic activity in the culture supernatant
14747189 existence of CX(3)CR1 (fractalkine receptor) in ejaculated sperm and present findings suggest that fractalkine in the Fallopian tube contributes to immunodefence mechanism during fertilization and to sperm motion in the oviduct
14688370 Soluble fractalkine antagonizes the chemoattractant effect of monocyte chemoattractant protein-1 on monocytes, probably by inhibiting crucial signaling pathways like those of stress-activated protein kinase 2/p38 and matrix metalloproteinase-2.
14665693 CX3CL1 acts as a receptor for pRBCs, and this may contribute to furthering our present understanding of cytoadherence in the pathology of falciparum malaria
14657873 increased circulating levels in symptomatic allergic rhinitis and asthmatic patients
14581400 a subset of mononuclear cells expresses high levels of fractalkine in human coronary atherosclerotic plaques and smooth muscle cells within the neointima express the fractalkine receptor CX3CR1
14580149 Results show that hypoxia inhibited the expression of fractalkine mRNA and protein by interferon-gamma, and this effect was observed with concomitant increase in vascular endothelial growth factor expression.
14533779 CX3CL1 is constitutively expressed in human brain; no evidence for expression differences of CX3CL1 is found between control patients and multiple sclerosis patients.
14514721 Fractalkine might contribute to direct mononuclear cells into peritubular interstitium and enhance their adhesion property, which in turn would favor inflammation and disease progression.
12969992 Review. New concepts underlying fractalkine-mediated leukocyte migration & tissue damage, the pathophysiological roles of fractalkine in various clinical conditions, especially in atherosclerosis & vascular injury, are reviewed.
12969973 expression of the fractalkine receptor on platelets
12824004 CX3CL1 directly promotes monocyte antiinflammatory and antiprocoagulant responses
12810688 These results demonstrate that fractalkine preferentially mediates arrest and migration of CD16+ monocytes.
12727021 Expressed in human skin keratinocytes
12667665 The finding of increased levels of fractalkine in the blood during subacute and chronic CNS inflammation suggests that it may be an interesting regulator of leukocyte extravasation into the inflamed brain.
12639246 intrathecal fractalkine release was observed in the majority of patients with HIV infections, with highest levels in CSF and serum of HIV-iduced CNS disorders.
12616493 endothelial expression of membrane-associated fractalkine may be an important contributing mechanism by which monocytes are selectively recruited to inflamed tissue
12569179 It is present, and its gene expressed, in amniotic fluid during pregnancy.
12551893 linkage relationships between CX3CR1 promoter polymorphisms and two previously described CX3CR1 coding polymorphisms associated with human immunodeficiency virus disease progression and arteriosclerosis susceptibility.
12125082 Fractalkine released by injured neurons could induce proliferation, activation and/or migration of microglia at the injured brain sites.
12100035 CX3CR1/fractalkine interactions accounted for 26% of THP-1 cell and 17% of peripheral blood NK cell adhesion to renal tubular epithelial cells, suggesting a functional role in leucocyte adhesion/retention in acute renal inflammation.
12076860 the fractalkine system is up-regulated during liver damage, and suggests that fractalkine may play a role in the recruitment and adhesion of inflammatory cells and in the biology of liver epithelial cells.
12055230 CX3CR1 defines peripheral blood cytotoxic effector lymphocytes commonly armed with intracellular perforin and granzyme B, which include NK cells, gamma delta T cells, and terminally differentiated CD8+ T cells.
12042278 Detection of fractalkine in human seminal plasma and its role in infertile patients.
12016106 We conclude that inflammatory mechanisms involving chemokine fractalkine and its receptor CX(3)CR1 may have a role in the natural history of Pulmonary Arterial Hypertension.
11909868 CX3CR1 tyrosine sulfation enhances fractalkine-induced cell adhesion
11777952 The role of smooth muscle cell-derived fractalkine in vascular inflammation is dependent on the synergism of TNF-alpha and IFN-gamma as well as the activity of fractalkine-cleaving metalloproteinase.
10869418 HIV-1 Tat-mediated downregulation of CX3CR1 inhibits CX3CL1-induced migration of microglia
10640747 HIV-1 Tat-mediated downregulation of CX3CR1 inhibits CX3CL1-induced migration of microglia
9826729 HIV-1 Tat-mediated downregulation of CX3CR1 inhibits CX3CL1-induced migration of microglia

AA Sequence

MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQH      1 - 70
RLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEP     71 - 140
TPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLW    141 - 210
AEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGP    211 - 280
GSMAHVSVVPVSSEGTPSREPVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLG    281 - 350
LLFCLGVAMFTYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV                           351 - 397
//

Text Mined References (224)

PMID Year Title
26796342 2016 Transmembrane chemokines act as receptors in a novel mechanism termed inverse signaling.
26718770 2016 CX3CL1 increases invasiveness and metastasis by promoting epithelial-to-mesenchymal transition through the TACE/TGF-?/EGFR pathway in hypoxic androgen-independent prostate cancer cells.
26633537 2015 Examination of the Fractalkine and Fractalkine Receptor Expression in Fallopian Adenocarcinoma Reveals Differences When Compared to Ovarian Carcinoma.
26632602 2016 CX3CL1--a macrophage chemoattractant induced by a single bout of exercise in human skeletal muscle.
26586708 2015 Elevated Local and Serum CX3CL1(Fractalkine) Expression and Its Association with Disease Severity in Patients with Psoriasis.
26558776 2015 Fractalkine Signaling Regulates Macrophage Recruitment into the Cochlea and Promotes the Survival of Spiral Ganglion Neurons after Selective Hair Cell Lesion.
26496926 2015 Upregulation of fractalkine contributes to the proliferative response of prostate cancer cells to hypoxia via promoting the G1/S phase transition.
26191329 2015 Gene-gene interactions among CX3CL1, LEPR and IL-6 related to coronary artery disease in Chinese Han population.
26168217 2015 T lymphocytes and fractalkine contribute to myocardial ischemia/reperfusion injury in patients.
26080445 2015 Rationally designed chemokine-based toxin targeting the viral G protein-coupled receptor US28 potently inhibits cytomegalovirus infection in vivo.
26074318 2015 Circulating cytokines reflect the expression of pro-inflammatory cytokines in atherosclerotic plaques.
26049921 2015 Changes in fractalkine in patients with ST-elevation myocardial infarction.
25962684 2015 Role of chemokine CX3CL1 in progression of multiple myeloma via CX3CR1 in bone microenvironments.
25845619 2015 Chemokine CX3CL1 and its receptor CX3CR1 are associated with human atherosclerotic lesion volnerability.
25795074 2015 Serum Fractalkine (CX3CL1) and Cardiovascular Outcomes and Diabetes: Findings From the Chronic Renal Insufficiency Cohort (CRIC) Study.
25769431 2015 Placental fractalkine is up-regulated in severe early-onset preeclampsia.
25745166 2015 Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor.
25692263 2015 Fractalkine (CX3CL1): a biomarker reflecting symptomatic severity in patients with knee osteoarthritis.
25596843 2015 Changes in the expression of genes related to neuroinflammation over the course of sporadic Alzheimer's disease progression: CX3CL1, TREM2, and PPAR?.
25596452 2015 The role of fractalkine (CX3CL1) in regulation of CD4(+) cell migration to the central nervous system in patients with relapsing-remitting multiple sclerosis.
25566740 2015 Placental fractalkine mediates adhesion of THP-1 monocytes to villous trophoblast.
25503251 2014 CX3CL1/CX3CR1 and CCL2/CCR2 chemokine/chemokine receptor complex in patients with AMD.
25480631 2015 Increase of serum fractalkine and fractalkine gene expression levels in sickle cell disease patients.
25435433 2015 MicroRNA-29b regulates migration in oral squamous cell carcinoma and its clinical significance.
25420917 2015 Involvement of the CX3CL1 (fractalkine)/CX3CR1 pathway in the pathogenesis of acute graft-versus-host disease.
25359863 2014 Fractalkine promotes human monocyte survival via a reduction in oxidative stress.
25320221 2014 Role of fractalkine in the pathogenesis of primary Sjögren syndrome: increased serum levels of fractalkine, its expression in labial salivary glands, and the association with clinical manifestations.
25253723 2014 Cytoskeletal confinement of CX3CL1 limits its susceptibility to proteolytic cleavage by ADAM10.
25040843 2014 Functional analysis of the fractalkine gene promoter in human aortic smooth muscle cells exposed to proinflammatory conditions.
24935307 2014 Serum fractalkine and interferon-gamma inducible protein-10 concentrations are early detection markers for acute renal allograft rejection.
24930044 2014 Fractalkine levels are elevated early after PCI-treated ST-elevation myocardial infarction; no influence of autologous bone marrow derived stem cell injection.
24789099 2014 The chemokine fractalkine can activate integrins without CX3CR1 through direct binding to a ligand-binding site distinct from the classical RGD-binding site.
24788416 2014 Insulin resistance aggravates atherosclerosis by reducing vascular smooth muscle cell survival and increasing CX3CL1/CX3CR1 axis.
24764683 2014 Preliminary study correlating CX3CL1/CX3CR1 expression with gastric carcinoma and gastric carcinoma perineural invasion.
24676787 2014 High coexpression of CCL2 and CX3CL1 is gender-specifically associated with good prognosis in soft tissue sarcoma patients.
24673545 2014 Serum levels of fractalkine are associated with markers of insulin resistance in gestational diabetes.
24632971 Circulating human fractalkine is decreased post-operatively after orthopedic and coronary bypass surgery.
24603149 2014 CX3CL1(+) microparticles mediate the chemoattraction of alveolar macrophages toward apoptotic acute promyelocytic leukemic cells.
24427339 2014 The M2 polarization of macrophage induced by fractalkine in the endometriotic milieu enhances invasiveness of endometrial stromal cells.
24352739 2013 Neuron-glia crosstalk in health and disease: fractalkine and CX3CR1 take centre stage.
24336891 2014 Fractalkine promotes platelet activation and vascular dysfunction in congestive heart failure.
24324211 2014 CX3CL1 and CX3CR1 expression in tertiary lymphoid structures in salivary gland infiltrates: fractalkine contribution to lymphoid neogenesis in Sjogren's syndrome.
24307760 2013 Plasma granzyme B in ST elevation myocardial infarction versus non-ST elevation acute coronary syndrome: comparisons with IL-18 and fractalkine.
24294368 2013 MiR-195 inhibits proliferation and growth and induces apoptosis of endometrial stromal cells by targeting FKN.
24270813 2014 CX3CL1 (fractalkine) and TNF? production by perfused human placental lobules under normoxic and hypoxic conditions in vitro: the importance of CX3CR1 signaling.
24185682 2014 Chemokine-chemokine receptor CCL2-CCR2 and CX3CL1-CX3CR1 axis may play a role in the aggravated inflammation in primary biliary cirrhosis.
24068281 2013 Crosstalk between monocytes and renal mesangial cells via interaction of metalloproteinases and fractalkine in diabetic nephropathy.
24060055 2013 Hypertrophy of the ligament flavum in degenerative lumbar stenosis associated with the increased expression of fractalkine (CX3CL1)/CX3CR1 chemokine.
24006262 2013 The chemokine CX3CL1 promotes trafficking of dendritic cells through inflamed lymphatics.
23974513 2013 Chemokines and atherosclerosis: focus on the CX3CL1/CX3CR1 pathway.
23956503 2013 Fractalkine (CX3CL1) and its receptor CX3CR1 may contribute to increased angiogenesis in diabetic placenta.
23912959 2013 CX3CL1 expression is associated with poor outcome in breast cancer patients.
23897050 2013 Role of ADAM-17, p38 MAPK, cathepsins, and the proteasome pathway in the synthesis and shedding of fractalkine/CX? CL1 in rheumatoid arthritis.
23887641 2013 Pharmacological inhibition of the chemokine receptor, CX3CR1, reduces atherosclerosis in mice.
23857671 2013 The CX3CL1/CX3CR1 reprograms glucose metabolism through HIF-1 pathway in pancreatic adenocarcinoma.
23765988 2014 A role for the chemokine receptor CCR6 in mammalian sperm motility and chemotaxis.
23724129 2013 Histone deacetylases and NF-kB signaling coordinate expression of CX3CL1 in epithelial cells in response to microbial challenge by suppressing miR-424 and miR-503.
23645563 2013 Expression of the chemokines CXCL12 and CX3CL1 and their receptors in human nerve sheath tumors.
23584220 2013 Immunohistohemical expression of the chemokine fractalkine and its receptor in the human brain cortex after severe traumatic brain injury and brain hemorrhage.
23477808 2013 Elevated plasma fractalkine levels are associated with higher levels of IL-6, Apo-B, LDL-C and insulin, but not with body composition in a large female twin sample.
23470165 2013 Interaction between CX3CL1 and CX3CR1 regulates vasculitis induced by immune complex deposition.
23332170 2013 Fractalkine overexpression suppresses tau pathology in a mouse model of tauopathy.
23303826 2013 Human cytomegalovirus chemokine receptor US28 induces migration of cells on a CX3CL1-presenting surface.
23261412 2013 Contribution of putative genetic factors and candidate gene variants to inter-individual variation of circulating fractalkine (CX3CL1) levels in a large UK twins' sample.
23229614 2013 The transmembrane chemokines CXCL16 and CX3CL1 and their receptors are expressed in human meningiomas.
23168573 2013 Glomerular expression of fractalkine is induced by polyinosinic-polycytidylic acid in human mesangial cells: possible involvement of fractalkine after viral infection.
23125415 2012 Integrins ?v?3 and ?4?1 act as coreceptors for fractalkine, and the integrin-binding defective mutant of fractalkine is an antagonist of CX3CR1.
23117657 2013 Arterial and venous endothelia display differential functional fractalkine (CX3CL1) expression by angiotensin-II.
23086480 2013 Inflammatory effects of resistin on human smooth muscle cells: up-regulation of fractalkine and its receptor, CX3CR1 expression by TLR4 and Gi-protein pathways.
23029290 2012 Fibroblast growth factor receptor 1 activation in mammary tumor cells promotes macrophage recruitment in a CX3CL1-dependent manner.
23014777 2012 Fractalkine is an independent predictor of mortality in patients with advanced heart failure.
23002075 2012 Hypoxia-induced endothelial CX3CL1 triggers lung smooth muscle cell phenotypic switching and proliferative expansion.
22916279 2012 Fractalkine is expressed in early and advanced atherosclerotic lesions and supports monocyte recruitment via CX3CR1.
22897138 2012 Fractalkine and its receptor (CX3CR1) in patients with stable coronary artery disease and diabetes mellitus.
22798324 2012 Higher plasma fractalkine is associated with better 6-month outcome from ischemic stroke.
22739755 2012 Fractalkine--a local inflammatory marker aggravating platelet activation at the vulnerable plaque.
22709495 2012 Fractalkine stimulates cell growth and increases its expression via NF-?B pathway in RA-FLS.
22692452 2012 CX3CL1 expression in the conjunctiva is involved in immune cell trafficking during toxic ocular surface inflammation.
22664781 2012 Independent roles of monocyte chemoattractant protein-1, regulated on activation, normal T-cell expressed and secreted and fractalkine in the vulnerability of coronary atherosclerotic plaques.
22652599 2012 Fractalkine activates a signal transduction pathway similar to P2Y12 and is associated with impaired clopidogrel responsiveness.
22641052 2012 siRNA knockdown of ADAM-10, but not ADAM-17, significantly reduces fractalkine shedding following pro-inflammatory cytokine treatment in a human adult brain endothelial cell line.
22639377 2012 High expression of CX3CL1/CX3CR1 axis predicts a poor prognosis of pancreatic ductal adenocarcinoma.
22572859 2012 Activated innate immunity and the involvement of CX3CR1-fractalkine in promoting hematuria in patients with IgA nephropathy.
22422195 2012 High expression of CX3CL1 by tumor cells correlates with a good prognosis and increased tumor-infiltrating CD8+ T cells, natural killer cells, and dendritic cells in breast carcinoma.
22394569 2012 Serum level of soluble CX3CL1/fractalkine is elevated in patients with polymyositis and dermatomyositis, which is correlated with disease activity.
22322207 2012 Correlation of serum CX3CL1 level with disease activity in adult-onset Still's disease and significant involvement in hemophagocytic syndrome.
22321225 2011 [Roles of monocyte chemoattractant protein-1, RANTES and Fractalkine on promoting vulnerability of atherosclerotic plaques].
22177089 2012 Fractalkine (CX3CL1) levels in patients with Behçet's disease and neuro-Behçet's disease.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22123179 2012 CX(3)CR1 drives cytotoxic CD4(+)CD28(-) T cells into the brain of multiple sclerosis patients.
21829356 2011 Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor.
21768350 2011 Serine protease autotransporters from Shigella flexneri and pathogenic Escherichia coli target a broad range of leukocyte glycoproteins.
21750716 2011 Identification of the chemokine CX3CL1 as a new regulator of malignant cell proliferation in epithelial ovarian cancer.
21638128 2011 CCL5, CXCL16, and CX3CL1 are associated with Henoch-Schonlein purpura.
21546901 2011 A novel role of the CX3CR1/CX3CL1 system in the cross-talk between chronic lymphocytic leukemia cells and tumor microenvironment.
21527754 2011 Amyloid beta enhances migration of endothelial progenitor cells by upregulating CX3CR1 in response to fractalkine, which may be associated with development of choroidal neovascularization.
21525510 2011 Fractalkine is a novel human adipochemokine associated with type 2 diabetes.
21463954 2011 High plasma fractalkine (CX3CL1) levels are associated with severe liver disease in HIV/HCV co-infected patients with HCV genotype 1.
21398580 2011 The CX3C chemokine fractalkine mediates platelet adhesion via the von Willebrand receptor glycoprotein Ib.
21168500 2011 Mesenchymal stem cell transplantation modulates neuroinflammation in focal cerebral ischemia: contribution of fractalkine and IL-5.
20922190 2010 Effects of pro-inflammatory cytokines on the production of soluble fractalkine and ADAM17 by HepG2 cells.
20880200 2010 CX3CL1 expression induced by Candida albicans in oral fibroblasts.
20869263 2010 Delta chemokine (fractalkine)--a novel mediator of pulmonary arterial hypertension in children undergoing cardiac surgery.
20668227 2010 ATP secreted by endothelial cells blocks CX?CL 1-elicited natural killer cell chemotaxis and cytotoxicity via P2Y?? receptor activation.
20664972 2010 Down-regulation of fractalkine inhibits the in vitro and in vivo angiogenesis of the hepatocellular carcinoma HepG2 cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20559678 2010 Requirements for leukocyte transmigration via the transmembrane chemokine CX3CL1.
20512991 2010 CX(3)CR1 and vascular adhesion protein-1-dependent recruitment of CD16(+) monocytes across human liver sinusoidal endothelium.
20511186 2010 CX3CR1/CX3CL1 axis negatively controls glioma cell invasion and is modulated by transforming growth factor-?1.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20482449 2010 Exploration of disease mechanism in acute kidney injury using a multiplex bead array assay: a nested case-control pilot study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20237149 2010 Thromboxane prostanoid receptor stimulation induces shedding of the transmembrane chemokine CX3CL1 yet enhances CX3CL1-dependent leukocyte adhesion.
20231691 2010 Characterization of synergistic induction of CX3CL1/fractalkine by TNF-alpha and IFN-gamma in vascular endothelial cells: an essential role for TNF-alpha in post-transcriptional regulation of CX3CL1.
20158572 2011 Enhanced platelet adhesion induces angiogenesis in intestinal inflammation and inflammatory bowel disease microvasculature.
20041188 2009 CX3CR1 is expressed by human B lymphocytes and mediates [corrected] CX3CL1 driven chemotaxis of tonsil centrocytes.
20034466 2010 Similar effects of resistin and high glucose on P-selectin and fractalkine expression and monocyte adhesion in human endothelial cells.
20019415 2010 Upregulation of fractalkine and its receptor, CX3CR1, is associated with coronary plaque rupture in patients with unstable angina pectoris.
19923448 2009 Role of CX3CL1/fractalkine in osteoclast differentiation and bone resorption.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851523 2009 Patients with insulin-dependent diabetes or coronary heart disease following rehabilitation express serum fractalkine levels similar to those in healthy control subjects.
19850645 2010 Rosiglitazone activation of PPARgamma suppresses fractalkine signaling.
19840952 2010 Fractalkine has anti-apoptotic and proliferative effects on human vascular smooth muscle cells via epidermal growth factor receptor signalling.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19723636 2009 Constitutive endocytosis of the chemokine CX3CL1 prevents its degradation by cell surface metalloproteases.
19605482 2009 The carboxy-terminal tail of human cytomegalovirus (HCMV) US28 regulates both chemokine-independent and chemokine-dependent signaling in HCMV-infected cells.
19563789 2009 Fractalkine and CX3CR1 are involved in the migration of intravenously grafted human bone marrow stromal cells toward ischemic brain lesion in rats.
19432809 2009 CX3CL1/fractalkine shedding by human hepatic stellate cells: contribution to chronic inflammation in the liver.
19372452 2009 Fractalkine receptor/ligand genetic variants and carotid intima-media thickness.
19369458 2009 Correlation of CX3CL1 and CX3CR1 levels with response to infliximab therapy in patients with rheumatoid arthritis.
19351602 2009 Resistin up-regulates fractalkine expression in human endothelial cells: lack of additive effect with TNF-alpha.
19327232 Elevated serum levels of soluble CX3CL1 in patients with microscopic polyangiitis.
19324423 2009 Expression of ADAM-17, TIMP-3 and fractalkine in the human adult brain endothelial cell line, hCMEC/D3, following pro-inflammatory cytokine treatment.
19214751 2009 WIN55,212-2 inhibits production of CX3CL1 by human astrocytes: involvement of p38 MAP kinase.
19155311 2009 Membrane microvesicles as actors in the establishment of a favorable prostatic tumoral niche: a role for activated fibroblasts and CX3CL1-CX3CR1 axis.
19153557 2009 Neural fractalkine expression is closely linked to pain and pancreatic neuritis in human chronic pancreatitis.
19132243 2008 High glucose conditions induce upregulation of fractalkine and monocyte chemotactic protein-1 in human smooth muscle cells.
19047106 2008 Chemokine markers predict biochemical recurrence of prostate cancer following prostatectomy.
19030200 2008 Fractalkine and TGF-beta1 levels reflect the severity of chronic pancreatitis in humans.
18938112 2009 Chemokines and common variable immunodeficiency; possible contribution of the fractalkine system (CX3CL1/CX3CR1) to chronic inflammation.
18800027 2008 Urinary fractalkine is a marker of acute rejection.
18799722 2008 CX3CL1/fractalkine is released from apoptotic lymphocytes to stimulate macrophage chemotaxis.
18799080 Increased serum fractalkine in systemic sclerosis. Down-regulation by prostaglandin E1.
18778890 2009 The involvement of the fractalkine receptor in the transmigration of neuroblastoma cells through bone-marrow endothelial cells.
18725411 2008 Functional adhesiveness of the CX3CL1 chemokine requires its aggregation. Role of the transmembrane domain.
18606701 2008 Fractalkine and CX3CR1 mediate leukocyte capture by endothelium in response to Shiga toxin.
18523306 2008 Antigen presentation by human microvascular endothelial cells triggers ICAM-1-dependent transendothelial protrusion by, and fractalkine-dependent transendothelial migration of, effector memory CD4+ T cells.
18436581 2008 Thrombin-induced expression of endothelial CX3CL1 potentiates monocyte CCL2 production and transendothelial migration.
18367676 2008 CX3CL1 and CCL14 regulate extracellular matrix and adhesion molecules in the trophoblast: potential roles in human embryo implantation.
18296082 2008 Characterisation of fractalkine/CX3CL1 and fractalkine receptor (CX3CR1) expression in abdominal aortic aneurysm disease.
18230685 2008 Glucocorticoid suppression of CX3CL1 (fractalkine) by reduced gene promoter recruitment of NF-kappaB.
18006432 2008 Activation of fractalkine/CX3CR1 by vascular endothelial cells induces angiogenesis through VEGF-A/KDR and reverses hindlimb ischaemia.
17907166 2007 Fractalkine mediates T cell-dependent proliferation of synovial fibroblasts in rheumatoid arthritis.
17895402 2008 Endothelial damage from cytomegalovirus-specific host immune response can be prevented by targeted disruption of fractalkine-CX3CR1 interaction.
17885215 2007 Fractalkine upregulates intercellular adhesion molecule-1 in endothelial cells through CX3CR1 and the Jak Stat5 pathway.
17611763 2007 Polymorphisms of Fractalkine receptor CX3CR1 and plasma levels of its ligand CX3CL1 in colorectal cancer patients.
17505143 2007 CX3CR1 polymorphisms are associated with atopy but not asthma in German children.
17487393 2007 Activation of human natural killer cells by recombinant membrane-expressed fractalkine on the surface of tumor cells.
17471309 2007 Recruitment of CD16+ monocytes into synovial tissues is mediated by fractalkine and CX3CR1 in rheumatoid arthritis patients.
17415055 2007 Polymorphisms in the 3' untranslated region of the fractalkine (CX3CL1) gene and the risk of HIV-1 infection and disease progression.
17241867 2007 Enhanced recruitment of CX3CR1+ T cells by mucosal endothelial cell-derived fractalkine in inflammatory bowel disease.
17132725 2007 Involvement of the fractalkine pathway in the pathogenesis of childhood hemolytic uremic syndrome.
17082482 2007 The CX3C chemokine fractalkine induces vascular dysfunction by generation of superoxide anions.
17075825 2006 Increased serum levels of soluble fractalkine (CX3CL1) correlate with disease activity in rheumatoid vasculitis.
17062081 2006 The CX3C-chemokine fractalkine (CX3CL1) is detectable in serum of patients affected by active pityriasis rosea.
17002687 2006 The CX3CL1-CX3CR1 system and psoriasis.
16877565 2006 Fractalkine stimulates angiogenesis by activating the Raf-1/MEK/ERK- and PI3K/Akt/eNOS-dependent signal pathways.
16767549 2006 Fractalkine in rheumatoid arthritis and allied conditions.
16645504 2006 T280M variation of the CX3C receptor gene is associated with increased risk for severe respiratory syncytial virus bronchiolitis.
16224053 2005 Expression of fractalkine (CX3CL1) and its receptor, CX3CR1, is elevated in coronary artery disease and is reduced during statin therapy.
15774461 2005 Recycling of the membrane-anchored chemokine, CX3CL1.
15726664 2005 Fractalkine and CX3CR1 are involved in the recruitment of intraepithelial lymphocytes of intrahepatic bile ducts.
15621116 2004 Quantitative gene expression analysis of fractalkine using laser microdissection in biopsies from kidney allografts with acute rejection.
15579768 2004 Coexpression of fractalkine and its receptor in normal human endometrium and in endometrium from users of progestin-only contraception supports a role for fractalkine in leukocyte recruitment and endometrial remodeling.
15529011 2004 The chemokine fractalkine in patients with severe traumatic brain injury and a mouse model of closed head injury.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361546 2004 Viral macrophage inflammatory protein-II and fractalkine (CX3CL1) chimeras identify molecular determinants of affinity, efficacy, and selectivity at CX3CR1.
15223613 2004 Involvement of fractalkine and macrophage inflammatory protein-1 alpha in moderate-severe depression.
15131578 2004 Expression of fractalkine and its receptor, CX3CR1, in atopic dermatitis: possible contribution to skin inflammation.
15111313 2004 Tumor necrosis factor-alpha induces fractalkine expression preferentially in arterial endothelial cells and mithramycin A suppresses TNF-alpha-induced fractalkine expression.
15013759 2004 TNF-alpha and IL-4 regulate expression of fractalkine (CX3CL1) as a membrane-anchored proadhesive protein and soluble chemotactic peptide on human fibroblasts.
14747189 2004 Expression of fractalkine in the Fallopian tube and of CX3CR1 in sperm.
14688370 2004 Soluble fractalkine prevents monocyte chemoattractant protein-1-induced monocyte migration via inhibition of stress-activated protein kinase 2/p38 and matrix metalloproteinase activities.
14665693 2003 Binding of Plasmodium falciparum-infected erythrocytes to the membrane-bound form of Fractalkine/CX3CL1.
14657873 2003 The CX3C chemokine fractalkine in allergic asthma and rhinitis.
14581400 2003 Smooth muscle cells in human atherosclerotic plaques express the fractalkine receptor CX3CR1 and undergo chemotaxis to the CX3C chemokine fractalkine (CX3CL1).
14580149 2003 Effect of hypoxia on the expression of fractalkine in human endothelial cells.
14533779 2003 CX3CL1 and CX3CR1 expression in human brain tissue: noninflammatory control versus multiple sclerosis.
14514721 2003 Protein overload induces fractalkine upregulation in proximal tubular cells through nuclear factor kappaB- and p38 mitogen-activated protein kinase-dependent pathways.
12969992 2004 Fractalkine in vascular biology: from basic research to clinical disease.
12969973 2004 Novel role of the membrane-bound chemokine fractalkine in platelet activation and adhesion.
12824004 2003 Fractalkine/CX3CL1 production by human aortic smooth muscle cells impairs monocyte procoagulant and inflammatory responses.
12810688 2003 Fractalkine preferentially mediates arrest and migration of CD16+ monocytes.
12727021 2003 Human keratinocytes express fractalkine/CX3CL1.
12714508 2003 The disintegrin-like metalloproteinase ADAM10 is involved in constitutive cleavage of CX3CL1 (fractalkine) and regulates CX3CL1-mediated cell-cell adhesion.
12667665 2003 CSF and serum levels of soluble fractalkine (CX3CL1) in inflammatory diseases of the nervous system.
12639246 2003 Increased intrathecal release of soluble fractalkine in HIV-infected patients.
12616493 2003 Human fractalkine mediates leukocyte adhesion but not capture under physiological shear conditions; a mechanism for selective monocyte recruitment.
12569179 2003 Fractalkine (FRK) levels in amniotic fluid and its production during pregnancy.
12551893 2003 Genomic organization and evolution of the CX3CR1/CCR8 chemokine receptor locus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12126650 2002 Molecular cloning and sequencing of 25 different rhesus macaque chemokine cDNAs reveals evolutionary conservation among C, CC, CXC, AND CX3C families of chemokines.
12125082 2002 Fractalkine and fractalkine receptors in human neurons and glial cells.
12076860 2002 Up-regulated expression of fractalkine and its receptor CX3CR1 during liver injury in humans.
12055230 2002 Dual functions of fractalkine/CX3C ligand 1 in trafficking of perforin+/granzyme B+ cytotoxic effector lymphocytes that are defined by CX3CR1 expression.
12042278 2002 Detection of fractalkine in human seminal plasma and its role in infertile patients.
12016106 2002 CX(3)C chemokine fractalkine in pulmonary arterial hypertension.
11909868 2002 CX3CR1 tyrosine sulfation enhances fractalkine-induced cell adhesion.
11495925 2001 Tumor necrosis factor-alpha-converting enzyme (ADAM17) mediates the cleavage and shedding of fractalkine (CX3CL1).
11238035 2001 The transmembrane form of the CX3CL1 chemokine fractalkine is expressed predominantly by epithelial cells in vivo.
10940926 2000 Mast cells migrate, but do not degranulate, in response to fractalkine, a membrane-bound chemokine expressed constitutively in diverse cells of the skin.
10770945 2000 The crystal structure of the chemokine domain of fractalkine shows a novel quaternary arrangement.
10731151 2000 Rapid progression to AIDS in HIV+ individuals with a structural variant of the chemokine receptor CX3CR1.
10640747 2000 Neuronal fractalkine expression in HIV-1 encephalitis: roles for macrophage recruitment and neuroprotection in the central nervous system.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10458770 1999 Fractalkine, a CX3C chemokine, is expressed by dendritic cells and is up-regulated upon dendritic cell maturation.
9931005 1999 Solution structure and dynamics of the CX3C chemokine domain of fractalkine and its interaction with an N-terminal fragment of CX3CR1.
9726990 1998 Identification of CX3CR1. A chemotactic receptor for the human CX3C chemokine fractalkine and a fusion coreceptor for HIV-1.
9691168 1998 Human chemokines fractalkine (SCYD1), MDC (SCYA22) and TARC (SCYA17) are clustered on chromosome 16q13.
9390561 1997 Identification and molecular characterization of fractalkine receptor CX3CR1, which mediates both leukocyte migration and adhesion.
9177350 1997 Neurotactin, a membrane-anchored chemokine upregulated in brain inflammation.
9024663 1997 A new class of membrane-bound chemokine with a CX3C motif.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.