Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 152.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.6e-03

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 5.6e-03

Gene RIF (1)

AA Sequence

MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAA      1 - 70
AREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKER     71 - 140
AEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRF    141 - 210
VNDTLRSEFHKKFMEKYIK                                                       211 - 229
//

Text Mined References (21)

PMID Year Title