Property Summary

NCBI Gene PubMed Count 15
PubMed Score 47.26
PubTator Score 54.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.700 5.3e-03
psoriasis -2.200 3.3e-26
glioblastoma -5.000 1.0e-05
oligodendroglioma -1.800 1.4e-07
osteosarcoma -2.424 2.9e-05
posterior fossa group B ependymoma -3.200 2.1e-05
atypical teratoid / rhabdoid tumor -2.600 7.1e-03
medulloblastoma, large-cell -3.700 7.6e-04
pancreatic ductal adenocarcinoma liver m... -1.922 7.5e-04
lung cancer 2.900 1.5e-03
cystic fibrosis -2.700 3.6e-05
adult high grade glioma -4.700 6.9e-06
pilocytic astrocytoma -5.100 1.1e-10
Breast cancer -1.100 1.7e-04
ovarian cancer -2.200 5.7e-06
pituitary cancer -1.700 2.5e-03

Gene RIF (4)

PMID Text
26221032 results suggest that the persistent expression of CUX2 in postmitotic neurons contributes to the maintenance of genome integrity through its stimulation of oxidative DNA damage repair.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAANVGSMFQYWKRFDLRRLQKELNSVASELSARQEESEHSHKHLIELRREFKKNVPEEIREMVAPVLKS      1 - 70
FQAEVVALSKRSQEAEAAFLSVYKQLIEAPDPVPVFEAARSLDDRLQPPSFDPSGQPRRDLHTSWKRNPE     71 - 140
LLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVL    141 - 210
HSALKATQAELLELRRKYDEEAASKADEVGLIMTNLEKANQRAEAAQREVESLREQLASVNSSIRLACCS    211 - 280
PQGPSGDKVNFTLCSGPRLEAALASKDREILRLLKDVQHLQSSLQELEEASANQIADLERQLTAKSEAIE    281 - 350
KLEEKLQAQSDYEEIKTELSILKAMKLASSTCSLPQGMAKPEDSLLIAKEAFFPTQKFLLEKPSLLASPE    351 - 420
EDPSEDDSIKDSLGTEQSYPSPQQLPPPPGPEDPLSPSPGQPLLGPSLGPDGTRTFSLSPFPSLASGERL    421 - 490
MMPPAAFKGEAGGLLVFPPAFYGAKPPTAPATPAPGPEPLGGPEPADGGGGGAAGPGAEEEQLDTAEIAF    491 - 560
QVKEQLLKHNIGQRVFGHYVLGLSQGSVSEILARPKPWRKLTVKGKEPFIKMKQFLSDEQNVLALRTIQV    561 - 630
RQRGSITPRIRTPETGSDDAIKSILEQAKKEIESQKGGEPKTSVAPLSIANGTTPASTSEDAIKSILEQA    631 - 700
RREMQAQQQALLEMEVAPRGRSVPPSPPERPSLATASQNGAPALVKQEEGSGGPAQAPLPVLSPAAFVQS    701 - 770
IIRKVKSEIGDAGYFDHHWASDRGLLSRPYASVSPSLSSSSSSGYSGQPNGRAWPRGDEAPVPPEDEAAA    771 - 840
GAEDEPPRTGELKAEGATAEAGARLPYYPAYVPRTLKPTVPPLTPEQYELYMYREVDTLELTRQVKEKLA    841 - 910
KNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLSDQLGQAVGQQPGASQASPTE    911 - 980
PRSSPSPPPSPTEPEKSSQEPLSLSLESSKENQQPEGRSSSSLSGKMYSGSQAPGGIQEIVAMSPELDTY    981 - 1050
SITKRVKEVLTDNNLGQRLFGESILGLTQGSVSDLLSRPKPWHKLSLKGREPFVRMQLWLNDPHNVEKLR   1051 - 1120
DMKKLEKKAYLKRRYGLISTGSDSESPATRSECPSPCLQPQDLSLLQIKKPRVVLAPEEKEALRKAYQLE   1121 - 1190
PYPSQQTIELLSFQLNLKTNTVINWFHNYRSRMRREMLVEGTQDEPDLDPSGGPGILPPGHSHPDPTPQS   1191 - 1260
PDSETEDQKPTVKELELQEGPEENSTPLTTQDKAQVRIKQEQMEEDAEEEAGSQPQDSGELDKGQGPPKE   1261 - 1330
EHPDPPGNDGLPKVAPGPLLPGGSTPDCPSLHPQQESEAGERLHPDPLSFKSASESSRCSLEVSLNSPSA   1331 - 1400
ASSPGLMMSVSPVPSSSAPISPSPPGAPPAKVPSASPTADMAGALHPSAKVNPNLQRRHEKMANLNNIIY   1401 - 1470
RVERAANREEALEWEF                                                         1471 - 1486
//

Text Mined References (18)

PMID Year Title
26221032 2015 CUX2 protein functions as an accessory factor in the repair of oxidative DNA damage.
23364394 2013 A genome-wide association study of a coronary artery disease risk variant.
22293688 2012 1000 Genomes-based imputation identifies novel and refined associations for the Wellcome Trust Case Control Consortium phase 1 Data.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16541075 2006 The finished DNA sequence of human chromosome 12.
15656993 2005 Biochemical characterization of the mammalian Cux2 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389760 2005 Linkage disequilibrium mapping of bipolar affective disorder at 12q23-q24 provides evidence for association at CUX2 and FLJ32356.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11353453 2001 CUX2, a potential regulator of NCAM expression: genomic characterization and analysis as a positional candidate susceptibility gene for bipolar disorder.
9446557 1998 DNA binding by cut homeodomain proteins is down-modulated by casein kinase II.
9179496 1997 Construction and characterization of human brain cDNA libraries suitable for analysis of cDNA clones encoding relatively large proteins.
8798433 1996 Primary structure, neural-specific expression, and chromosomal localization of Cux-2, a second murine homeobox gene related to Drosophila cut.