Property Summary

NCBI Gene PubMed Count 82
PubMed Score 421.36
PubTator Score 800.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 2.600 5.8e-04
malignant mesothelioma -1.100 4.0e-06
astrocytoma 1.900 1.2e-03
ependymoma 1.400 1.7e-02
oligodendroglioma 1.700 3.8e-03
psoriasis 1.300 2.2e-04
atypical teratoid / rhabdoid tumor 1.500 2.9e-04
medulloblastoma 1.500 1.8e-03
medulloblastoma, large-cell -1.500 3.7e-03
pancreatic ductal adenocarcinoma liver m... 1.202 5.4e-04
intraductal papillary-mucinous adenoma (... 1.500 1.7e-03
intraductal papillary-mucinous carcinoma... 1.500 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.1e-03
Pick disease 1.100 2.8e-07
ovarian cancer -2.800 3.0e-15
pituitary cancer -1.200 2.1e-04

Protein-protein Interaction (2)

Gene RIF (53)

PMID Text
25248790 High CUX1 expression is associated with metastasis in pancreatic neuroendocrine neoplasms.
25190083 CUX1 expression is associated with tumour progression and tumor burden. [Review]
25159843 CASP is specifically cleaved by granzymeB.
25124494 This is a novel gene implicated in atrial fibrillation
25096634 Results show that Cux1 is expressed in cerebellar granule cell precursors and downregulated as they terminally differentiate; coexpression analysis in human medulloblastomas suggests another function related to DNA integrity and stability
24686420 Suggest that CUTL1 may regulate the proliferation of malignant melanoma by modulating the expression of cell cycle-related proteins.
24429498 Loss of CUX1 is associated with myeloid neoplasms.
24336331 Authors identified CUX1 as an important modulator of the TAMs phenotype and function by modulating NF-kappaB-dependent cytokines.
24316979 Cux1 is a tumor suppressor and inactivating CUX1 mutations promote tumorigenesis.
23590133 p110 CUX1 can mediate transcriptional repression or activation of specific genes when bound at variable distances from the transcription start site.
23255599 overexpression of active CUTL1 significantly resulted in increased cancer tissue response to chemotherapy and therefore inhibited growth, whereas knockdown of CUTL1 conferred resistance to chemotherapy.
23212519 Data indicate CUX1 as a conserved, haploinsufficient tumor suppressor frequently deleted in myeloid neoplasms.
23085261 Cutl1 played transcriptional level mediated by signal transduction, translational level mediated by miR122, posttranslational level such as phosphorylation, de-phosphorylation, acetylation and proteolytic cleavage.
22965931 Authors found that both chromosomal inversions target the cut-like homeobox 1 (CUX1) gene on chromosomal band 7q22.1 in a way which is functionally equivalent to the more frequently observed del(7q) cases.
22584459 Our results provide the first evidence that polymorphisms of the CUX1 gene may be associated with response to antidepressant treatment in Japanese patients with MDD.
22438831 we find repression of apoptosis regulators by Cux1 in human cancer cells.
22306263 cux1 is associated with cell functions and human disease.
22180456 The data demonstrates that the autism spectrum disorder-associated A-C intronic haplotype of the ENGRAILED2 gene is a transcriptional activator, and both CUX1 and NFIB mediate this activity.
21674579 screening for mutations in CUX1 using 15 secondary acute myeloid leukemia cases with preceding myeloproliferative neoplasms or loss-of-heterozygosity on chromosome 7q (collaborative study in several countries)
21471005 modifications of CUX1 expression lead to aberrant expression of type I collagen, which may provide a molecular basis for fibrogenesis
21330321 we identified a novel CUX1-FGFR1 fusion oncogene in a patient with the 8p11 myeloproliferative syndrome and demonstrated its transforming potential in the Ba/F3 cell line.
21245318 Transcriptional targets of CUX1 involved in DNA replication and bipolar mitosis defined a gene expression signature that, across 12 breast cancer gene expression datasets, was associated with poor clinical outcome.
20848487 Elevated levels of cux1 are associated with inflammatory bowel disease.
20842632 findings show that CUTL1 expression is gradually silenced at the posttranscriptional level during liver development; overexpression and knockdown studies that miR-122 repressed CUTL1 protein expression in HCC cell lines
20689760 GRIA3 plays a role as a mediator of tumor progression in pancreatic cancer downstream CUX1.
20442202 data indicate that CUX1 represents an important survival factor downstream of PI3K/Akt, which orchestrates a transcriptional programme mediating resistance to apoptosis in pancreatic cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19635798 role of p110 CUX1 in cell motility involves its functions in both activation and repression of transcription
19590514 Observational study of gene-disease association. (HuGE Navigator)
19361498 Activation of non-canonical Wnt signaling pathway by EBV in epithelial cells suggests a novel mechanism of epithelial mesenchymal transition via CUX1 signaling.
19015243 study reports that mitotic complex genes Ect2, RacGAP, and MKLP1 are coordinately induced in S phase in proliferating T lymphocytes as well as in epithelial cells, depending upon activity of the CUX1 and E2F1 transcription factors
18614194 CUX1 showed evidence of association with the HCMV major immediate early regulatory region and inhibited the capacity of the virus to express ie1 and ie2 transcripts, suggesting that this cellular factor regulates MIE gene expression following virus entry.
18403643 This result revealed a negative feedback loop whereby CUX1 shuts down the expression of the protease that cleaves it.
18347061 Genome-wide location analysis revealed that targets common to p110 CUX1 and E2F1 included many genes involved in cell cycle, DNA replication, and DNA repair.
17957475 The data strongly suggest that CDP acts as a major suppressor for Human papillomavirus type 16 P670 transcription by binding to the promoter region in the undifferentiated cells
17682059 Data show that in renal cell carcinoma, the Cut-like homeodomain protein is involved in FIH-1 transcriptional regulation and is controlled by a specific signaling event involving protein kinase C zeta.
17681953 CUX1 C-terminal proteolytic processing by a caspase enables transcriptional activation in proliferating cells
17496784 CDP inhibits cytokine-induced NF-kappaB-regulated chemokine transcription in melanoma cells
17369846 Src plays a crucial role in CUTL1-induced tumor cell migration
17227781 CUTL1 transcriptionally up-regulates WNT5A on RNA, protein and promoter level.
17140660 Single Nucleotide Polymorphism in CUTL1 is associated with myeloid neoplasias
16574653 PKA-induced phosphorylation results in decreased DNA binding affinity of CUTL1 and diminished CUTL1-mediated cell cycle progression and cell motility.
16529788 Binding of E2 at the binding sites play an important role in overcoming inhibition of E1 complex formation caused by the binding of CDP to the origin of replication.
15950902 CUTL1 plays a central role in coordinating a gene expression program associated with cell motility and tumor progression.
15269344 interaction of G9a with a sequence-specific transcription factor that regulates gene repression through CDP/cut.
12766905 our data suggested that somatic mutations in CDP gene were rare in unselected uterine leiomyomas
12743282 CDP, in conjunction with one or more viral proteins, binds to the packaging sequences of Adenovirus type 5 to initiate the encapsidation process
12665598 correlation between binding of CDP/Cux to the DNA pol alpha promoter and the stimulation of gene expression
12522000 Lack of LF expression in the acute promyelocytic leukemia cell line NB4 is associated with the persistent binding of the silencer CCAAT displacement protein (CDP/cut) to the LF promoter in these cells.
12429822 Data report the characterization of a mammalian coiled-coil protein, CASP, a Golgi protein that shares with giantin a conserved histidine in its transmembrane domain.
12193717 Analysis of flanking sequences of IgH and Ig kappa V region genes show extensive heterogeneity in frequency and location of CDP binding sites and capability of CDP to bind to the nuclear matrix.
11953010 Transfection of keratinocytes with plasmid DNA leads to the loss of detectable DNA-binding activity of CCAAT displacement protein.

AA Sequence

MAANVGSMFQYWKRFDLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKS      1 - 70
FQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEF     71 - 140
AEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQS    141 - 210
LQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSANHSLQLASQ    211 - 280
IQKAPDVEQAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLK    281 - 350
QLEEKLKGQADYEEVKKELNILKSMEFAPSEGAGTQDAAKPLEVLLLEKNRSLQSENAALRISNSDLSGR    351 - 420
CAELQVRITEAVATATEQRELIARLEQDLSIIQSIQRPDAEGAAEHRLEKIPEPIKEATALFYGPAAPAS    421 - 490
GALPEGQVDSLLSIISSQRERFRARNQELEAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGR    491 - 560
GSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTIGFFYTLFLHC    561 - 630
LVFLVLYKLAWSESMERDCATFCAKKFADHLHKFHENDNGAAAGDLWQ                          631 - 678
//

Text Mined References (87)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25248790 2014 CUX1: a modulator of tumour aggressiveness in pancreatic neuroendocrine neoplasms.
25190083 2014 CUX1, a haploinsufficient tumour suppressor gene overexpressed in advanced cancers.
25159843 2014 Cytohesin-associated scaffolding protein (CASP) is a substrate for granzyme B and ubiquitination.
25124494 2014 Integrating genetic, transcriptional, and functional analyses to identify 5 novel genes for atrial fibrillation.
25096634 2014 The transcription factor Cux1 in cerebellar granule cell development and medulloblastoma pathogenesis.
24686420 2014 The transcription factor CUTL1 is associated with proliferation and prognosis in malignant melanoma.
24429498 2014 Recurrent genetic defects on chromosome 7q in myeloid neoplasms.
24336331 2015 CUX1 modulates polarization of tumor-associated macrophages by antagonizing NF-?B signaling.
24316979 2014 Inactivating CUX1 mutations promote tumorigenesis.
23590133 2013 Long-range transcriptional regulation by the p110 CUX1 homeodomain protein on the ENCODE array.
23255599 2013 Transcription factor CUTL1 is a negative regulator of drug resistance in gastric cancer.
23212519 2013 CUX1 is a haploinsufficient tumor suppressor gene on chromosome 7 frequently inactivated in acute myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085261 2013 Cutl1: a potential target for cancer therapy.
22965931 2013 Identification of CUX1 as the recurrent chromosomal band 7q22 target gene in human uterine leiomyoma.
22584459 2013 Possible association of CUX1 gene polymorphisms with antidepressant response in major depressive disorder.
22438831 2012 Antagonistic regulation of apoptosis and differentiation by the Cut transcription factor represents a tumor-suppressing mechanism in Drosophila.
22306263 2012 CUX1 transcription factors: from biochemical activities and cell-based assays to mouse models and human diseases.
22180456 2012 Cut-like homeobox 1 and nuclear factor I/B mediate ENGRAILED2 autism spectrum disorder-associated haplotype function.
21674579 2011 Novel CUX1 missense mutation in association with 7q- at leukemic transformation of MPN.
21471005 2011 High doses of TGF-? potently suppress type I collagen via the transcription factor CUX1.
21330321 2011 The kinase inhibitor TKI258 is active against the novel CUX1-FGFR1 fusion detected in a patient with T-lymphoblastic leukemia/lymphoma and t(7;8)(q22;p11).
21269460 2011 Initial characterization of the human central proteome.
21245318 2011 Cut homeobox 1 causes chromosomal instability by promoting bipolar division after cytokinesis failure.
20848487 2010 Cux1 transcription factor is induced in inflammatory bowel disease and protects against experimental colitis.
20842632 2010 Liver-enriched transcription factors regulate microRNA-122 that targets CUTL1 during liver development.
20689760 2010 Glutamate receptor GRIA3--target of CUX1 and mediator of tumor progression in pancreatic cancer.
20442202 2010 CUX1: target of Akt signalling and mediator of resistance to apoptosis in pancreatic cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19635798 2009 p110 CUX1 homeodomain protein stimulates cell migration and invasion in part through a regulatory cascade culminating in the repression of E-cadherin and occludin.
19590514 2009 FGFR2 is associated with hair thickness in Asian populations.
19361498 2009 CUX1/Wnt signaling regulates epithelial mesenchymal transition in EBV infected epithelial cells.
19015243 2009 CUX1 and E2F1 regulate coordinated expression of the mitotic complex genes Ect2, MgcRacGAP, and MKLP1 in S phase.
18614194 2008 Repression of human cytomegalovirus major immediate early gene expression by the cellular transcription factor CCAAT displacement protein.
18403643 2008 Proteolytic processing of cut homeobox 1 by neutrophil elastase in the MV4;11 myeloid leukemia cell line.
18347061 2008 p110 CUX1 cooperates with E2F transcription factors in the transcriptional activation of cell cycle-regulated genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17957475 2007 Human papillomavirus type 16 P670 promoter is negatively regulated by CCAAT displacement protein.
17682059 2007 Protein kinase C-mediated modulation of FIH-1 expression by the homeodomain protein CDP/Cut/Cux.
17681953 2007 Carboxyl-terminal proteolytic processing of CUX1 by a caspase enables transcriptional activation in proliferating cells.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17496784 2007 CCAAT displacement protein regulates nuclear factor-kappa beta-mediated chemokine transcription in melanoma cells.
17369846 2007 CUTL1 promotes tumor cell migration by decreasing proteasome-mediated Src degradation.
17227781 2007 WNT5A--target of CUTL1 and potent modulator of tumor cell migration and invasion in pancreatic cancer.
17140660 2007 Mutation analysis of CUTL1 in childhood myeloid neoplasias with monosomy 7.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16574653 2006 CUTL1 is phosphorylated by protein kinase A, modulating its effects on cell proliferation and motility.
16529788 2006 Interactions of the cellular CCAAT displacement protein and human papillomavirus E2 protein with the viral origin of replication can regulate DNA replication.
15950902 2005 CUTL1 is a target of TGF(beta) signaling that enhances cancer cell motility and invasiveness.
15718469 2005 Golgin tethers define subpopulations of COPI vesicles.
15656993 2005 Biochemical characterization of the mammalian Cux2 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15269344 2004 CCAAT displacement protein/cut homolog recruits G9a histone lysine methyltransferase to repress transcription.
15099520 2004 A cathepsin L isoform that is devoid of a signal peptide localizes to the nucleus in S phase and processes the CDP/Cux transcription factor.
15004235 2004 The COG and COPI complexes interact to control the abundance of GEARs, a subset of Golgi integral membrane proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12891711 2003 Tumor suppressor pRB functions as a co-repressor of the CCAAT displacement protein (CDP/cut) to regulate cell cycle controlled histone H4 transcription.
12853948 2003 The DNA sequence of human chromosome 7.
12766905 2003 Mutation analysis of CDP, TP53, and KRAS in uterine leiomyomas.
12743282 2003 Binding of CCAAT displacement protein CDP to adenovirus packaging sequences.
12665598 2003 CDP/Cux stimulates transcription from the DNA polymerase alpha gene promoter.
12522000 2003 Chromatin immunoprecipitation (ChIP) studies indicate a role for CCAAT enhancer binding proteins alpha and epsilon (C/EBP alpha and C/EBP epsilon ) and CDP/cut in myeloid maturation-induced lactoferrin gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438259 2002 Characterization of a tissue-specific CDP/Cux isoform, p75, activated in breast tumor cells.
12429822 2002 CASP, the alternatively spliced product of the gene encoding the CCAAT-displacement protein transcription factor, is a Golgi membrane protein related to giantin.
12193717 2002 High frequency of matrix attachment regions and cut-like protein x/CCAAT-displacement protein and B cell regulator of IgH transcription binding sites flanking Ig V region genes.
12115525 2002 Expression of N-terminally truncated isoforms of CDP/CUX is increased in human uterine leiomyomas.
12052827 2002 The N-terminal coiled coil domain of the cytohesin/ARNO family of guanine nucleotide exchange factors interacts with the scaffolding protein CASP.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11584018 2001 Phosphorylation of the CCAAT displacement protein (CDP)/Cux transcription factor by cyclin A-Cdk1 modulates its DNA binding activity in G(2).
11509674 2001 S phase-specific proteolytic cleavage is required to activate stable DNA binding by the CDP/Cut homeodomain protein.
11403998 2001 Role of the multifunctional CDP/Cut/Cux homeodomain transcription factor in regulating differentiation, cell growth and development.
11371564 2001 The role of CDP in the negative regulation of CXCL1 gene expression.
10852958 2000 Regulation of the homeodomain CCAAT displacement/cut protein function by histone acetyltransferases p300/CREB-binding protein (CBP)-associated factor and CBP.
10803519 2000 CDP/Cut DNA binding activity is down-modulated in granulocytes, macrophages and erythrocytes but remains elevated in differentiating megakaryocytes.
10607901 2000 Exon/intron structure and alternative transcripts of the CUTL1 gene.
10373541 1999 Homeoproteins CDP and SATB1 interact: potential for tissue-specific regulation.
9799793 1998 Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes.
9792700 1998 A nuclear matrix attachment region upstream of the T cell receptor beta gene enhancer binds Cux/CDP and SATB1 and modulates enhancer-dependent reporter gene expression but not endogenous gene expression.
9332351 1997 CASP, a novel, highly conserved alternative-splicing product of the CDP/cut/cux gene, lacks cut-repeat and homeo DNA-binding domains, and interacts with full-length CDP in vitro.
8662884 1996 Schwann cells secrete a novel collagen-like adhesive protein that binds N-syndecan.
8468066 1993 Regional localization of the CCAAT displacement protein gene (CUTL1) to 7q22 by analysis of somatic cell hybrids.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2481658 1989 DNA sequences regulating human globin gene transcription in nondeletional hereditary persistence of fetal hemoglobin.
1301999 1992 Human CCAAT displacement protein is homologous to the Drosophila homeoprotein, cut.