Property Summary

NCBI Gene PubMed Count 17
PubMed Score 50.80
PubTator Score 26.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.300 3.9e-02
acute quadriplegic myopathy -1.182 9.3e-05
ductal carcinoma in situ -1.100 1.7e-03
fibroadenoma -1.100 2.9e-02
malignant mesothelioma 1.400 5.6e-07
osteosarcoma -2.003 2.0e-05
pituitary cancer 1.100 4.1e-05

Gene RIF (3)

AA Sequence

MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVV      1 - 70
KQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPL     71 - 140
PVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQ    141 - 210
RILEGSGATEFHCSARSTRDSGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV           211 - 273
//

Text Mined References (20)

PMID Year Title