Property Summary

NCBI Gene PubMed Count 15
PubMed Score 47.46
PubTator Score 26.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.400 5.6e-07
osteosarcoma -2.003 2.0e-05
acute quadriplegic myopathy -1.182 9.3e-05
fibroadenoma -1.100 2.9e-02
ductal carcinoma in situ -1.100 1.7e-03
acute myeloid leukemia -1.300 3.9e-02
pituitary cancer 1.100 4.1e-05

Synonym

Accession Q9NTM9 Q5TCZ8 Q9Y321
Symbols CGI-32

Gene

PANTHER Protein Class (2)

PDB

3IWP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
19878721 Results suggest that hCutC functions as an enzyme with Cu(I) as a cofactor rather than a copper transporter and the potential Cu(I)-binding site consists of the two Cys residues and other conserved residues in the vicinity.
16182249 Cloning, expression and subcellular localization of CutC.

AA Sequence

MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVV      1 - 70
KQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPL     71 - 140
PVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQ    141 - 210
RILEGSGATEFHCSARSTRDSGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV           211 - 273
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19878721 2010 Crystal structure of human copper homeostasis protein CutC reveals a potential copper-binding site.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16182249 2005 Identification and characterization of a novel Cut family cDNA that encodes human copper transporter protein CutC.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
7635807 1995 Identification of cutC and cutF (nlpE) genes involved in copper tolerance in Escherichia coli.