Property Summary

NCBI Gene PubMed Count 44
PubMed Score 34.10
PubTator Score 36.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.171 2.8e-02
atypical teratoid / rhabdoid tumor 1.600 8.2e-09
diabetes mellitus -1.200 1.8e-03

Protein-protein Interaction (3)

Gene RIF (25)

PMID Text
26962950 Cullin7 may serve as an indicator of poor prognosis in patients with epithelial ovarian cancer.
26488604 report an adult female with 3-M syndrome that was caused by novel compound heterozygous mutations (c.4023-1 G>A in splice acceptor site of exon 22 and c.4359_4363dupGGCTG in exon 23) in the CUL7 gene
25003318 study provided evidence that Cullin7 functions as a novel oncogene in breast cancer and may be a potential therapeutic target for breast cancer management
24793695 The CUL7, OBSL1, and CCDC8 proteins form a 3M complex that functions in maintaining microtubule and genome integrity and normal development.
24711643 CUL7, OBSL1 and CCDC8 modulate the alternative splicing of the INSR
24362026 CUL7/Fbxw8 ubiquitin ligase-mediated HPK1 degradation revealed a direct link and novel role of CUL7/Fbxw8 ubiquitin ligase in the MAPK pathway, which plays a critical role in cell proliferation and differentiation.
23517720 Homozygous deletion in exon 18 of the CUL7 gene, which has not been previously described, could be responsible for the 3-M syndrome.
23029530 Growth factor-stimulated TBC1D3 ubiquitination and degradation are regulated by its interaction with CUL7-Fbw8.
23018678 Mutations in CUL7, OBSL1 and CCDC8 in 3-M syndrome lead to disordered growth factor signalling.
22942238 This study demonstrates specific genomic alterations in HCC/MS and points to CUL7 as a novel gene potentially involved in liver carcinogenesis associated with metabolic Syndrome, the amplification of which might influence cell proliferation.
22524683 Dysregulation of Cul7 and Fbxw8 expression might affect trophoblast turnover in intrauterine growth restriction.
22156540 discussion of roles of CUL7, OBSL1 (obscurin-like 1), and CCDC8 (coiled-coil domain containing protein 8) in growth and development using findings from patients with Miller-McKusick-Malvaux syndrome and Silver-Russell syndrome [REVIEW]
21946088 binding of Cul1-Rbx1 to Cul7-Rbx1 is mediated via heterodimerization of Fbxw8 with other F-box proteins which function to recruit substrates into the E3 ligase complex
21737058 We propose that CUL7, OBSL1, and CCDC8 are members of a pathway controlling mammalian growth.
21396581 CUL7 appears to be the major gene responsible for 3M syndrome accounting for 77.5% of cases while OBSL1 mutations accounts for 16.3%[review]
20005570 CUL7 expression in placenta is up-regulated up to 10 times in intra-uterine growth restriction (IUGR) and up to 15 times in preeclampsia associated with IUGR; the CUL7 promoter is hypomethylated in IUGR.
19225462 in 33 novel cases of 3M syndrome, we identified deleterious CUL7 mutations in 23/33 patients, including 19 novel mutations & 1 paternal isodisomy of chromosome 6 encompassing a CUL7 mutation; findings also support genetic heterogeneity of this disease
17942889 CUL7 is a new oncogene that cooperates with Myc in transformation by blocking Myc-induced apoptosis in a p53-dependent manner.
17675530 A novel homozygous 4582insT mutation in CUL7 resulted in a frameshift mutation & a premature stop codon at 1553 (Q1553X)in Yakuts with short stature syndromes.
17586686 In a proteomic screen for p53 interactors the cullin protein Cul7 efficiently associates with p53.
17332328 PARC and CUL7 subcomplexes exhibit E3 ubiquitin ligase activity in vitro.
17298945 CPH domain interaction surface of p53 resides in the tetramerization domain and is formed by residues contributed by at least two subunits
16875676 p53-binding domain of CUL7 contributes to the cytoplasmic localization of CUL7
16547496 CUL7 functions to promote cell growth through, in part, antagonizing the function of p53
16142236 25 distinct mutations in the gene cullin 7 mappped to chromosome 6 were identified in 29 families with 3-M syndrome.

AA Sequence

MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMS      1 - 70
KDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEECVGTIPPAPLLHT     71 - 140
VHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWSAGRMIQALSSHDAGTRTQILLSLSQQEAIE    141 - 210
KHLDFDSRCALLALFAQATLSEHPMSFEGIQLPQVPGRVLFSLVKRYLHVTSLLDQLNDSAAEPGAQNTS    211 - 280
APEELSGERGQLELEFSMAMGTLISELVQAMRWDQASDRPRSSARSPGSIFQPQLADVSPGLPAAQAQPS    281 - 350
FRRSRRFRPRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRT    351 - 420
YWVHWHMLEILGFEEDIEDMVEADEYQGAVASRVLGRALPAWRWRPMTELYAVPYVLPEDEDTEECEHLT    421 - 490
LAEWWELLFFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLI    491 - 560
NCHVYKKYGPEALAGNQAYPSLLEAQEDVLLLDAQAQAKDSEDAAKVEAKEPPSQSPNTPLQRLVEGYGP    561 - 630
AGKILLDLEQALSSEGTQENKVKPLLLQLQRQPQPFLALMQSLDTPETNRTLHLTVLRILKQLVDFPEAL    631 - 700
LLPWHEAVDACMACLRSPNTDREVLQELIFFLHRLTSVSRDYAVVLNQLGARDAISKALEKHLGKLELAQ    701 - 770
ELRDMVFKCEKHAHLYRKLITNILGGCIQMVLGQIEDHRRTHQPINIPFFDVFLRYLCQGSSVEVKEDKC    771 - 840
WEKVEVSSNPHRASKLTDHNPKTYWESNGSAGSHYITLHMRRGILIRQLTLLVASEDSSYMPARVVVCGG    841 - 910
DSTSSLHTELNSVNVMPSASRVILLENLTRFWPIIQIRIKRCQQGGIDTRIRGLEILGPKPTFWPVFREQ    911 - 980
LCRHTRLFYMVRAQAWSQDMAEDRRSLLHLSSRLNGALRQEQNFADRFLPDDEAAQALGKTCWEALVSPV    981 - 1050
VQNITSPDEDGISPLGWLLDQYLECQEAVFNPQSRGPAFFSRVRRLTHLLVHVEPCEAPPPVVATPRPKG   1051 - 1120
RNRSHDWSSLATRGLPSSIMRNLTRCWRAVVEKQVNNFLTSSWRDDDFVPRYCEHFNILQNSSSELFGPR   1121 - 1190
AAFLLALQNGCAGALLKLPFLKAAHVSEQFARHIDQQIQGSRIGGAQEMERLAQLQQCLQAVLIFSGLEI   1191 - 1260
ATTFEHYYQHYMADRLLGVVSSWLEGAVLEQIGPCFPNRLPQQMLQSLSTSKELQRQFHVYQLQQLDQEL   1261 - 1330
LKLEDTEKKIQVGLGASGKEHKSEKEEEAGAAAVVDVAEGEEEEEENEDLYYEGAMPEVSVLVLSRHSWP   1331 - 1400
VASICHTLNPRTCLPSYLRGTLNRYSNFYNKSQSHPALERGSQRRLQWTWLGWAELQFGNQTLHVSTVQM   1401 - 1470
WLLLYLNDLKAVSVESLLAFSGLSADMLNQAIGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPRSRWDI   1471 - 1540
VRLIPPQTYLQAEGEDGQNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSL   1541 - 1610
GKGSACSSTDVLSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRS   1611 - 1680
RGVPYASCTATQSFSTFR                                                       1681 - 1698
//

Text Mined References (50)

PMID Year Title
26962950 2016 High Expression of Cullin7 Correlates with Unfavorable Prognosis in Epithelial Ovarian Cancer Patients.
26488604 2016 Changes in facial appearance from neonate to adult in 3-M syndrome patient with novel CUL7 gene mutations.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25003318 2014 Overexpressed ubiquitin ligase Cullin7 in breast cancer promotes cell proliferation and invasion via down-regulating p53.
24793696 2014 CUL9 mediates the functions of the 3M complex and ubiquitylates survivin to maintain genome integrity.
24793695 2014 The 3M complex maintains microtubule and genome integrity.
24711643 2014 Identifying biological pathways that underlie primordial short stature using network analysis.
24362026 2014 The CUL7/F-box and WD repeat domain containing 8 (CUL7/Fbxw8) ubiquitin ligase promotes degradation of hematopoietic progenitor kinase 1.
23517720 2013 3-M syndrome associated with growth hormone deficiency: 18 year follow-up of a patient.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23029530 2012 Ubiquitination and degradation of the hominoid-specific oncoprotein TBC1D3 is mediated by CUL7 E3 ligase.
23018678 2012 Mutations in CUL7, OBSL1 and CCDC8 in 3-M syndrome lead to disordered growth factor signalling.
22942238 2013 Cullin7: a new gene involved in liver carcinogenesis related to metabolic syndrome.
22653443 2012 Mutant p53 interactome identifies nardilysin as a p53R273H-specific binding partner that promotes invasion.
22524683 2012 Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?
22156540 2011 The genetics of 3-M syndrome: unravelling a potential new regulatory growth pathway.
21946088 2012 Characterization of the Cullin7 E3 ubiquitin ligase--heterodimerization of cullin substrate receptors as a novel mechanism to regulate cullin E3 ligase activity.
21778237 2011 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
21737058 2011 Exome sequencing identifies CCDC8 mutations in 3-M syndrome, suggesting that CCDC8 contributes in a pathway with CUL7 and OBSL1 to control human growth.
21572988 2011 An OBSL1-Cul7Fbxw8 ubiquitin ligase signaling mechanism regulates Golgi morphology and dendrite patterning.
21396581 2011 The 3M syndrome.
21269460 2011 Initial characterization of the human central proteome.
20139075 2010 Ubiquitin ligase cullin 7 induces epithelial-mesenchymal transition in human choriocarcinoma cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20005570 2010 Cullins in human intra-uterine growth restriction: expressional and epigenetic alterations.
19225462 2009 A large-scale mutation search reveals genetic heterogeneity in 3M syndrome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18498745 2008 The CUL7 E3 ubiquitin ligase targets insulin receptor substrate 1 for ubiquitin-dependent degradation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17942889 2007 CUL7 is a novel antiapoptotic oncogene.
17675530 2007 Clinical, molecular and histopathological features of short stature syndrome with novel CUL7 mutation in Yakuts: new population isolate in Asia.
17586686 2007 Induction of cullin 7 by DNA damage attenuates p53 function.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17332328 2007 PARC and CUL7 form atypical cullin RING ligase complexes.
17298945 2007 The conserved CPH domains of Cul7 and PARC are protein-protein interaction modules that bind the tetramerization domain of p53.
16875676 2006 A novel p53-binding domain in CUL7.
16547496 2006 Cytoplasmic localized ubiquitin ligase cullin 7 binds to p53 and promotes cell growth by antagonizing p53 function.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16142236 2005 Identification of mutations in CUL7 in 3-M syndrome.
16140746 2005 Simian virus 40 large T antigen's association with the CUL7 SCF complex contributes to cellular transformation.
15964813 2005 Dimerization of CUL7 and PARC is not required for all CUL7 functions and mouse development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12904573 2003 Targeted disruption of p185/Cul7 gene results in abnormal vascular morphogenesis.
12481031 2002 CUL7: A DOC domain-containing cullin selectively binds Skp1.Fbx29 to form an SCF-like complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
10531037 1999 A family of mammalian F-box proteins.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.